SecReT6
Protein ID: 397693186
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0416
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]473255..473824 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDI7AUH7
KEGG IDppx:T1E_0416
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.30E-09, Aligned region: 30..96
Protein Sequence: 189 a.a.     [Download]
>gi|397693186|ref|YP_006531066.1| FHA domain-containing protein [Pseudomonas putida DOT-T1E]
MNTVTLSITNLDQLQHGVTARHLFDCKGGTIGSGRANWQINDRDQTVAPIHCEIRWIEGSFCVIDHCHRT
YLNGSANSLGPLPPRRLVEGDQLLIGTYRLQVQYTQDQACTRSLEDLFNPDPRVLDRLIAEAPAPAWPAQ
PSAPQPAVEISSVFKAAMGNDPLAALDAADGEGALRESPLQRLIAGAYP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|397692770|ref|NC_018220.1|:473255-473824 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAACACAGTCACCTTGAGCATCACCAACCTCGACCAACTGCAGCACGGCGTTACTGCTCGGCACCTGT
TCGATTGCAAGGGCGGCACCATCGGCAGCGGGCGAGCAAACTGGCAGATCAATGACCGCGATCAGACCGT
TGCGCCCATCCACTGCGAAATCCGCTGGATCGAAGGCAGCTTCTGCGTGATCGACCACTGCCACCGCACC
TACCTCAATGGCAGTGCCAACAGCCTGGGGCCGCTTCCACCCAGACGCCTGGTTGAGGGTGACCAGCTTC
TCATTGGTACCTATCGGCTACAGGTTCAGTACACCCAGGATCAGGCCTGCACGCGCTCGCTGGAGGACCT
GTTCAACCCGGACCCGAGGGTGCTCGACCGCCTGATAGCGGAAGCGCCTGCACCCGCTTGGCCGGCACAG
CCTTCTGCCCCCCAACCAGCCGTCGAGATCTCCTCGGTCTTCAAAGCAGCCATGGGGAATGACCCTCTGG
CAGCGCTGGACGCAGCAGACGGTGAAGGGGCACTCCGAGAAAGCCCGCTGCAGCGCCTGATTGCCGGAGC
ATACCCATGA