SecReT6
Protein ID: 397693187
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0417
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]473821..474618 [+]
Producthypothetical protein
NoteTssJ
UniProt IDI7BZL7
KEGG IDppx:T1E_0417
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-24, Aligned region: 17..64
T6SS-SciN [PF12790], Evalue: 1.60E-24, Aligned region: 156..256
Protein Sequence: 265 a.a.     [Download]
>gi|397693187|ref|YP_006531067.1| hypothetical protein T1E_0417 [Pseudomonas putida DOT-T1E]
MKPHPLLLASLLLALVVPTGCTSLSRMSQVAMDHSLPIGPPKDHPTEVAFSINASPTLNGNPNSLDVAAE
QDSALEPSPYAVTLSAGDPYALTEKIGVLFEYLQAQFPAMSPVELDEGDESDPARSPLEESGPGSYDAPQ
VALTLPRTTSVASALVATPIAITILQLRDDSLLRNTVYQLLEQDPAKALRSTYIRSDDYLLRPGQFKYIP
FEPIHAETRFVAVIADYRGHENASWRQVLRIPPRGRQIMLSVLVNDTHIVLKEED
 
Nucleotide Sequence: 798 bp     [Download]
>gi|397692770|ref|NC_018220.1|:473821-474618 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAAGCCTCATCCACTTCTGCTCGCCAGCCTGCTGCTTGCGCTGGTCGTGCCCACCGGCTGTACCTCTT
TGAGCAGAATGAGCCAGGTGGCCATGGACCACTCGTTGCCCATCGGGCCGCCCAAGGATCACCCGACCGA
GGTCGCATTCAGCATCAATGCCAGCCCTACCCTCAACGGCAATCCGAACAGCCTTGACGTCGCAGCCGAA
CAGGATAGCGCCCTGGAGCCCAGCCCCTACGCTGTAACCCTGAGTGCTGGCGACCCCTATGCGTTGACCG
AAAAAATCGGGGTTCTGTTCGAATACCTGCAAGCGCAATTCCCGGCCATGTCTCCCGTCGAGCTGGACGA
AGGAGACGAAAGCGACCCGGCGCGCTCGCCCCTGGAAGAAAGCGGCCCCGGCAGCTACGACGCCCCTCAA
GTGGCGTTGACCTTGCCGCGCACCACAAGCGTTGCCTCAGCGCTGGTCGCTACGCCCATTGCCATCACGA
TCCTGCAACTGCGCGACGACTCACTGCTGCGCAACACCGTGTACCAGCTACTGGAGCAGGACCCGGCCAA
AGCGCTGCGCAGTACCTACATCCGCAGTGACGATTACCTGCTGCGCCCTGGCCAGTTCAAGTACATCCCG
TTCGAGCCTATCCACGCCGAAACCCGCTTCGTCGCGGTGATTGCCGATTACCGAGGGCATGAAAACGCCA
GTTGGCGGCAAGTTCTGCGCATTCCACCGCGTGGCCGCCAGATCATGCTGTCGGTGCTGGTCAACGACAC
GCACATCGTGCTCAAGGAAGAAGACTGA