SecReT6
Protein ID: 397693188
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0418
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]474674..476011 [+]
Producthypothetical protein
NoteTssK
UniProt IDI7BQ94
KEGG IDppx:T1E_0418
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-150, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|397693188|ref|YP_006531068.1| hypothetical protein T1E_0418 [Pseudomonas putida DOT-T1E]
MSSRNPVLWPEGLFVKPQHFQQATRASEAALHQRLASLNAAFYGFSELQLSDEYLSLGKVAITRARGVMP
DGTVFDIPADLPPPPPLEIGDDACKDSEVYLCLPLRTDGGREVSWPDNAANFRYTAQAQEIKDTHTADGD
LVQVDLAVPNLQLKRKTEDSSAYTRLALARILERRPDGSLQLDEAFYPTSVSVRAVPALQRFLEEITHTL
RERARGLATRIGASGQSGIADIRDFNLLQAMNRWWPCFQHLARQAQTHPEQLYLCMSQACGEFVTFTDQN
RLPQEYPAYHHTALRTSFKPLEDTLRRSLSTVLRPRAVSLPLESEQFGVMTTTLEDRRLIDEADFILAVR
ASMPPQALRQMFIQKAKITSLESLNDLVPLQLPGIPLLPLPVAPRDLPFHAGFSYFELDRRDPAWACMSK
ANGFGIHIAGDFPGLELQFWAIRSE
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|397692770|ref|NC_018220.1|:474674-476011 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAGTTCACGCAATCCCGTTCTCTGGCCCGAAGGCCTGTTCGTCAAACCACAGCATTTCCAGCAGGCGA
CCAGGGCCAGCGAAGCAGCCCTGCACCAGCGCCTCGCCAGCCTCAACGCAGCCTTCTACGGCTTCAGCGA
ACTTCAGTTGAGCGACGAATACCTGAGCCTGGGCAAAGTCGCCATCACCCGGGCGCGCGGTGTGATGCCG
GACGGCACGGTGTTCGACATTCCCGCCGACCTGCCGCCACCGCCGCCGCTGGAAATCGGCGACGACGCGT
GCAAAGACAGTGAGGTGTATCTGTGCCTGCCGCTGCGTACCGATGGCGGCCGCGAAGTGAGCTGGCCCGA
CAATGCAGCCAATTTCCGCTATACCGCCCAGGCACAGGAAATCAAGGATACCCACACCGCTGACGGTGAC
CTGGTGCAGGTAGACCTTGCGGTGCCCAACCTGCAGCTCAAACGCAAGACCGAAGACAGCAGCGCCTACA
CCCGCCTGGCCCTGGCACGTATTCTGGAACGGCGCCCCGACGGCAGCCTGCAACTGGACGAAGCGTTCTA
CCCCACCAGCGTTTCGGTGCGGGCGGTGCCAGCGCTGCAGCGGTTTCTTGAAGAAATCACCCATACCTTG
CGCGAGCGGGCGCGCGGCCTCGCCACGCGGATTGGTGCCTCGGGCCAGTCCGGGATCGCCGACATTCGCG
ACTTCAACCTGCTGCAGGCCATGAACCGTTGGTGGCCATGCTTCCAGCATCTGGCCAGGCAAGCGCAAAC
GCACCCCGAGCAGCTGTACCTGTGCATGAGCCAGGCCTGCGGCGAATTCGTCACCTTCACCGACCAGAAC
AGGCTGCCGCAGGAGTACCCCGCCTATCACCACACCGCGCTGCGCACCTCTTTCAAACCACTGGAAGACA
CCTTGCGTCGGTCTCTGAGCACCGTCTTGCGGCCACGCGCTGTTTCACTACCGCTGGAGAGCGAACAATT
CGGCGTGATGACGACCACGCTGGAAGACCGCCGGCTGATCGACGAAGCCGACTTCATCCTCGCCGTGCGC
GCCAGCATGCCACCACAGGCGTTGCGCCAGATGTTCATCCAGAAAGCCAAGATCACCTCGCTTGAGTCAC
TGAATGACCTGGTGCCGCTGCAATTGCCGGGCATCCCTTTGTTGCCATTACCCGTGGCGCCCCGCGACCT
GCCCTTCCATGCGGGCTTCAGCTACTTCGAGCTGGACCGACGAGACCCGGCCTGGGCGTGCATGAGCAAG
GCGAATGGCTTCGGCATCCACATTGCGGGCGACTTCCCAGGGCTTGAACTGCAGTTCTGGGCGATCAGGA
GTGAGTGA