SecReT6
Protein ID: 397693189
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0419
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]476013..476972 [+]
Producthypothetical protein
NoteTssL
UniProt IDI7B4P2
KEGG IDppx:T1E_0419
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.50E-59, Aligned region: 67..256
Protein Sequence: 319 a.a.     [Download]
>gi|397693189|ref|YP_006531069.1| hypothetical protein T1E_0419 [Pseudomonas putida DOT-T1E]
MGKDNNTPTDENNAAVNALDSTLEQPVPAPRAAATNAQVSTDKPEPEPVSEGYPADPEFQLRGGFANLML
DAASPLFGLVIRLRTLDELPNIQDVHQQVRGQIDNIQEEMRQHGYEPAQLLAYSYGLCLFIDEAVMERPW
GKSSCWSQEPLLSIFHDETWGGEKIFTVITRLMQEPKRYQDVLEFMYYALCLGLKGKYALAPKGEETLNA
LIHQLHGIIRELRGPTPEEVCDPYANVAPRNFRISRQWPWWSPLVIWPAAPVAPSARRGKPRRPAPAHAA
AVPGPGAGHRAMPAGGKGQFSARPRRVRACRRRNARRPG
 
Nucleotide Sequence: 960 bp     [Download]
>gi|397692770|ref|NC_018220.1|:476013-476972 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGGGAAAAGACAACAATACGCCCACCGATGAAAACAACGCTGCAGTCAACGCGCTTGATTCAACCCTTG
AACAGCCAGTACCCGCCCCCCGGGCTGCGGCAACCAATGCGCAAGTATCCACGGACAAACCTGAGCCTGA
GCCCGTTTCCGAAGGCTACCCCGCTGACCCGGAATTTCAGCTGCGGGGCGGCTTCGCCAACCTGATGCTG
GATGCCGCATCGCCGTTGTTCGGCTTGGTTATACGCCTGCGTACGCTGGACGAGCTGCCAAACATCCAGG
ACGTGCACCAGCAAGTGCGCGGCCAGATCGACAACATCCAGGAAGAAATGCGCCAGCACGGTTACGAGCC
GGCTCAGTTGCTGGCGTACTCCTACGGTCTGTGCCTGTTCATAGACGAGGCCGTTATGGAGCGCCCCTGG
GGCAAGAGCAGCTGCTGGAGCCAGGAGCCGCTGCTCAGCATCTTCCACGACGAGACCTGGGGTGGAGAAA
AAATCTTCACGGTGATTACCCGCCTGATGCAGGAGCCCAAGCGTTACCAGGACGTACTGGAGTTCATGTA
CTACGCCCTGTGCCTTGGGCTGAAGGGCAAGTACGCGCTCGCGCCGAAAGGCGAAGAAACACTCAACGCA
TTGATTCACCAACTGCACGGGATCATCCGCGAACTGCGCGGCCCTACCCCCGAAGAAGTCTGCGACCCCT
ACGCCAATGTGGCCCCACGCAACTTCCGCATAAGCCGGCAATGGCCCTGGTGGAGCCCCTTGGTGATTTG
GCCAGCTGCGCCAGTTGCGCCATCAGCCCGGCGGGGCAAGCCTCGCCGCCCAGCACCAGCGCACGCTGCG
GCAGTGCCCGGGCCGGGTGCGGGCCATCGAGCAATGCCTGCAGGTGGGAAGGGACAATTTTCAGCACGTC
CACGGCGTGTGCGTGCATGTAGGCGGCGAAACGCTCGGCGTCCAGGCTGA