SecReT6
Protein ID: 397695204
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2446
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2682360..2683445 [-]
Producthypothetical protein
NoteTssA
UniProt IDI7BA45
KEGG IDppx:T1E_2446
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-22, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 5.40E-22, Aligned region: 241..257
Protein Sequence: 361 a.a.     [Download]
>gi|397695204|ref|YP_006533085.1| hypothetical protein T1E_2446 [Pseudomonas putida DOT-T1E]
MPEILNDLSLATLVAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVINLSAQGL
AQQSKDLMLVAWLCEGLAQREHFEGITFGLELTEQLLVAFWETLYPTLEDGLDERAARLSWLKTTLTDIA
GGLPIIQGQHFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVALTDTDYLRAKAQQIATSL
NACKRLQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPAIPEEAQPQAMAANLHEAGEPM
NATPPTTAPAALRTTPLTRDEAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNV
VDNIRDVLGTR
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2683445-2682360 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCCTGAAATTCTCAATGACCTCTCGCTGGCCACACTGGTCGCCCCTATCGAGGGTGGCAGTGGTGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCACGCCGGGCGGACCCTGACTACCTGACCCA
GGGCGACTGGCAAACCGACTTGAAGACTGCCGACTGGGAGCAGGTGATCAACCTGTCGGCTCAAGGGCTT
GCGCAGCAAAGCAAAGACCTGATGCTGGTGGCCTGGCTCTGCGAGGGGCTGGCCCAACGTGAACACTTCG
AAGGCATCACCTTTGGCCTCGAGCTGACCGAACAGCTCCTGGTTGCGTTCTGGGAAACGCTGTATCCCAC
CCTCGAAGACGGCCTGGACGAGCGCGCGGCGCGACTGTCCTGGTTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTATCCAAGGGCAGCATTTTGGCGTGTTGCGCTATGACGAGTCACGCCATGTAGAAA
ACCTCGCCTTGCAAAACCCCAAGGCAATGCAGACAGCGCTGAACGAAGGCAAGATCAACGCCGAGATCTT
CCAGCGCTCGGTAGCGCTTACCGACACCGATTACCTGCGCGCCAAGGCCCAGCAGATCGCTACCAGCCTG
AATGCATGCAAACGCCTGCAGGCCAGCGCCGACCGCCTGTTCGGCCACGAGGCGCCCAGCTTTGCCAGCC
TTGCCGACATGCTTTCGCGTGCCAGCCAGCTGGCGGAAAAACTGCTCAAGGACCGCGGCGTAGAGCTTCA
CCCCGCCATCCCGGAAGAAGCACAGCCACAGGCCATGGCTGCCAACCTCCACGAAGCAGGTGAACCGATG
AATGCCACGCCCCCGACGACCGCGCCTGCCGCCCTGCGCACCACCCCGCTGACCCGCGACGAGGCATTCA
CCATGCTTGCGGGCATCGCCCAGTATTTCAAGCAGAGCGAACCGCAAAGCCCGGTACCCTACCTGATCGA
ACGTGCGATCAAGTGGGGCAACATGCCGTTGGAAGGCTGGTTGAGTGACGTGATCAAGGACAACAATGTG
GTGGACAACATCCGCGATGTGCTGGGTACCCGCTAG