SecReT6
Protein ID: 397695205
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2447
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2683541..2684059 [-]
Producthypothetical protein
NoteTssD
UniProt IDI7C946
KEGG IDppx:T1E_2447
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.00E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|397695205|ref|YP_006533086.1| hypothetical protein T1E_2447 [Pseudomonas putida DOT-T1E]
MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQNGEDKAVSDLPVEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2684059-2683541 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCAGGTGAAGTACTGGATGAAAAACACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACACAGGCTACGTCGGCAACCGCCAGCTCTTCGGGCGG
TGCGTCCTCCGAGCGCGTTGCCCTGAGCGACTTCAAGATCCGCAAGGCAGTCGACAAGGCATCGGCCAAA
CTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGCG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTGGTGGTCTCTTCGGTCAAGTTTGTCGCCGGTGG
CAACCAGAATGGTGAAGACAAGGCGGTCAGCGACCTGCCCGTTGAAGAAATCAGCTTCAACTTTGCCCGC
ATCAAAACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCCGGCGGCAACATCGTAGGTGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTAA