SecReT6
Protein ID: 397695209
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2451
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2691434..2692150 [-]
Producthypothetical protein
NoteTssL
UniProt IDI7BA50
KEGG IDppx:T1E_2451
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-53, Aligned region: 19..221
Protein Sequence: 238 a.a.     [Download]
>gi|397695209|ref|YP_006533090.1| hypothetical protein T1E_2451 [Pseudomonas putida DOT-T1E]
MTEAVLQQGAVPAASDKPTLKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFANLERDARAANYSVEQ
VKDTQYALCAFLDESVLRSDDNALRRHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2692150-2691434 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGACCGAAGCCGTACTGCAACAGGGCGCCGTCCCGGCCGCCAGCGACAAACCGACGCTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCGTTGATCGTACGTCGCGGCCGCCAGGTCACCTCGGTGCAGGCCTTCGA
AGGTAGCGTCGAACGCTTCTTCGCCAACCTGGAACGTGATGCCCGTGCCGCCAACTACAGCGTCGAGCAG
GTCAAGGACACCCAATACGCGTTGTGCGCCTTCCTCGACGAAAGCGTACTGCGCTCGGACGACAACGCGT
TGCGTCGGCACTTTGAACTTCAGCCGTTGCAGTTCCGCTATTTCGGCGTGCACCTGGCCGGCGAAGGCTT
CTTCGAGAAGGTCGATGCGCTGCGCGCCGACGTCAAGCAGAACATCGACGTGCTCGAGGTTTACCACCTT
TGCCTGGCACTGGGCTTCGAGGGCAAGTTCAGCCTCGGGCAGAAAGACCAGCTGCGTTACCTGGCCAATA
CCCTGGGCCAGGATATCGCCCGCTACCGCAAAGCGCCCAAAGCCCTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCATGAAGTACCGCTGTGGGTGTATCTGGCGCTGATCGCGTTGGTCTGC
GTCGCCGTGTACCTGACGCTGGACTGGTTGCTGGACAAGGACGTCGCCGCCCTGTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA