SecReT6
Protein ID: 397695210
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2452
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2692147..2693490 [-]
Producthypothetical protein
NoteTssK
UniProt IDI7C950
KEGG IDppx:T1E_2452
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-136, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|397695210|ref|YP_006533091.1| hypothetical protein T1E_2452 [Pseudomonas putida DOT-T1E]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLAKLTRNSMGGFNVDPHFVHPTLHLGSHETIAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYI
AVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGTVYER
MISAQAICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2693490-2692147 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTATCAGG
ACGAATTCCATCAGCACCAGTTGGCTGAGGCGACCCTGCGCAGCACCCCTTTCCATTGGGGGGTTCAGGC
GCTGCAGGTGGACGAGGACGCCCTGGCCAATGGTTCACTGCAGCTCAAGCGCCTGAAGCTGGTGTTCCCC
GATGGCAGCCTCTACGACGCGCCGCAGCACGATCCGCTGCCGGCCGCGCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTGAAGGTGTATGCCGCGCTCAAGCTGCCCGAGCCATTCGGCCTCAACTACGTCGAGGA
TGGCCACGAACACAAGGCCGCACGGCGTTTCCGCAAGCAGTTCGACACCCTGCCCGACCTTAATGAAGGC
GAGCTGGAAAACGAAATCACCAGCTTGCGCCTGAACGTCGTACTGCTGGTCGACGGTGACAGCCTCGACG
GTTACAGCCACTGCCCACTGGCCAAGCTGACACGCAACAGCATGGGCGGTTTCAACGTTGACCCGCATTT
CGTCCACCCCACCTTGCACCTGGGCAGCCACGAGACCATTGCAGGCATCGGCAAGCGCCTGCTCGGTGCC
CTGCAGGCCAAGAGCAAAGCGCTTTCCGGCCGGCGCCGCGAGCGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGATGTGACCCTGTTCTGGCTGCTGAACACGGTCAACCGTGCCCACCCGCAGCTGGCTCATCTACT
GGCCCACCCGCGCCTGCACCCAGAGCGCCTGTACCTGTTCCTGGCGGACCTTGCCGGCGGCCTGCTGACC
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAGTACGACCACCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAAATGATCCGGGTGATGCTCGACAACGTCGTGCCCAACCAGTGCATTGTCATCAACCTGAC
CCAGACCAAGCCATCGCACTGGCAAGGCCAACTGCACGACCCGCGCCTGGCCGAAGCCGACTTCTATATC
GCCGTGCACGCCGACATGCCCGGCGCCAGCCTGCTGGAGCTGGTGCCCCGTGCCTTCAAGGTCGGTTCGC
CGGAAGACATTGAAGTGGTGGTCAACAGCGCCATGCCGGGTGTCACCCTCAATCATGCCGCGCGGCTGCC
GAACGCGATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAACCACACGGCACTGTGTATGAGCGA
ATGATCAGCGCCCAGGCCATCTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA