SecReT6
Protein ID: 397695211
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2453
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2693487..2694209 [-]
Producthypothetical protein
NoteTssJ
UniProt IDI7AZX3
KEGG IDppx:T1E_2453
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-35, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|397695211|ref|YP_006533092.1| hypothetical protein T1E_2453 [Pseudomonas putida DOT-T1E]
MQHKHIVLKRLTAAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDAPEKALGNTLVETREITLLPGIGQIDQWPLAKNARYVGVAAFFRDEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKAKDADATLTDKVQD
AAIDKATDAASQSASNAMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2694209-2693487 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCAACACAAGCACATCGTCCTCAAACGCCTGACCGCAGCCGCCTTGCTGGTAGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGACGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTATCAGCTGACCGACCTCGAGCGCTTCGCGGCTACCGATGCCGAGACCCTGTGGGACGCCC
CGGAAAAAGCCTTGGGCAACACCCTGGTGGAAACCCGCGAGATCACCCTGCTGCCTGGCATTGGCCAGAT
CGACCAGTGGCCGCTGGCCAAGAACGCGCGCTACGTCGGCGTGGCGGCGTTCTTCCGCGACGAGCAGGAC
GCGCGCTGGAAAGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCCTCCGACGGCC
TGCGGGTGCTGGTGGACAACACCGAAATCAGCGCCATGCGGGGCGTGGACGTACTGAACAAACCGCCGAC
CGCCGACCAGCTTGCCGCTGCGCAGAAGGCCAAGGATGCCGACGCGACCCTCACCGACAAGGTGCAGGAC
GCGGCCATCGACAAAGCCACCGACGCCGCCAGCCAGTCGGCCAGCAACGCCATGGATTCAACCTTCAATT
CTTTAGTGGATAGCGTCAAATGA