SecReT6
Protein ID: 397695213
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2455
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2696828..2697814 [-]
Producthypothetical protein
NoteTssG
UniProt IDI7BVT2
KEGG IDppx:T1E_2455
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-97, Aligned region: 1..305
Protein Sequence: 328 a.a.     [Download]
>gi|397695213|ref|YP_006533094.1| hypothetical protein T1E_2455 [Pseudomonas putida DOT-T1E]
MRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEREGKVSPAGLPLSEVQVTFMGLVG
PSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFDGYLLNLVG
LGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVQPFAGRWLHLQPEQCTQ
LGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLNLADYQRFQPGTACYRKLVELVRFYIGAELDFEIAPRL
KREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL
 
Nucleotide Sequence: 987 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2697814-2696828 Pseudomonas putida DOT-T1E chromosome, complete genome
GTGCGCCTGCTCCGCCTGCATTACAGCCGCACCGGGCGCATGGACCTGGCAACCCGGCCGCACGAAGACC
CGCTGCGTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGACCTGCACTTCGAGCG
CGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCATGGGCCTGGTCGGG
CCGTCAGGCGTGCTGCCACGCCCGTACACCGAGCTGCTGCTCGAGCGCCACGTGCAGTATCGCGACGATG
CCGCCCATGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAGGCCTGGCAAAAATA
CAAATTCCACATCGAGCACGAGCGCAATGGCACTTCGGGCTTCGACGGCTACCTGCTCAACCTGGTTGGC
CTCGGGCCGCGCGCCCAGAAGCTGAAGTTCGAAGAGCAACCGTCAGCATTGCGTCGTGAGCTGTTCAGCT
ATTTTGCCGGCCTGCTCAGCCAGAAACCGCGCAATGCGCTGAACCTTGAACGCATGCTCGGTTTCTATTT
CTCGCTGCCGATCAAGGTCCAGCCGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCGAACAATGCACCCAG
CTTGGCCGCCGCAATGCCCAGCTCGGCCACAGCGCCGTCGCCGGCAACCGGGTCTGGGACTATCAGTCGT
GCATCCGTATCGAGCTGGGCCCGCTGAACCTGGCCGACTACCAGCGCTTCCAGCCGGGCACCGCCTGCTA
CCGCAAGCTGGTCGAGCTGGTGCGCTTCTATATAGGTGCCGAACTGGATTTCGAAATTGCCCCGCGCCTC
AAGCGCGAGGCGGTGCCACGCGCCCAACTGGGCCGCAGCGGCAATGTCGCCCTGGGCTGGCTGGGTTGGC
TCAAACGCCCGGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTTTTCCACATTCCTTACGATGGGGTCGC
CTTGTGA