SecReT6
Protein ID: 397695214
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2456
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2697862..2699682 [-]
Producthypothetical protein
NoteTssF
UniProt IDI7BA54
KEGG IDppx:T1E_2456
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-212, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|397695214|ref|YP_006533095.1| hypothetical protein T1E_2456 [Pseudomonas putida DOT-T1E]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIVELSLGRHEKVTEAYRVARHTEMHANPVEGVVCKFRTCYPVELWPIAV
QQASFTEMERSAFNGHSADLVARLRIRLAATGDALFGQMDMNRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFDDQGRRREVALPADALNTVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILQGKA
IEQVEVNFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVATCQPFFEPRGEQDPHSSFWVARRRNQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLMLPFGGERGDFTIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHLSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVF
LFGKVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2699682-2697862 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTTCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAGATCGCTTCGCGGCTGCTGATCGAAGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAGGCCTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAACTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTCGAGGTGCTGTACCCCCACTACCTGCGCCCTACTCCGTCGATGTCGATTGTCG
AACTGAGCCTGGGCAGGCACGAAAAAGTCACCGAAGCCTACCGCGTGGCGCGCCATACCGAGATGCATGC
CAATCCCGTGGAAGGCGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCACAGAAATGGAACGCTCGGCCTTCAACGGGCACAGCGCCGACCTGGTCGCTCGTC
TGCGCATCCGCCTGGCAGCCACGGGCGATGCCCTGTTCGGGCAGATGGACATGAACCGCCTGCGGTTCTT
CCTCGACGGCGAAGCAACCCTGATGCTGCAGCTGTACGAGCTGCTGTTCAACAACCTGGCCAAGGCCACG
CTGAGCTTCGACGACCAGGGCCGCCGCCGCGAAGTGGCGCTGCCGGCCGATGCCCTGAACACCGTGGGCT
ACGCCCGTGACGAAGGCCTGGTGGACTACTCCGAGCGCTCATTCCTGGGCTACCGCCTGCTGCACGAGTA
TTTCACCTTCCCCGACAAGTTCATGTTCTTCGACCTCAGTGGATTTGCCCGCATCCTGCAGGGCAAGGCC
ATCGAGCAGGTAGAGGTCAACTTCTATTTCTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACCC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACGCCGATCATCAACCTGTTCCGCCAGCAGGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAATACCCGGTCACCCCTGACACACGGCTGCACAACGCTGCA
GAAGTGGTATCGATCGACCGGGTACGGCGGGTGCGCAAACTCGGCGGTATCGACCAGGTCGCCACCTGCC
AGCCGTTTTTCGAACCCCGGGGCGAGCAAGACCCACACAGCAGCTTCTGGGTCGCGCGCCGGCGAAACCA
GGGTGACGCCACTGCCATGAGCATCCGCGTGGTCGACCGCGATCTGGAACTGATCGACGCCAGCAGCGAC
ACCCTCAGTATCGGCCTTACCTGCAGCAACCGCGACGTGCCGCTGATGCTGCCGTTCGGTGGCGAACGGG
GCGATTTCACCATTCCCGCCAACTCGGTGATCAAGGATATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGTGTGCCCTTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACCTGTCGCTGAACCATCTGTCCCTG
GTCAGCCAGGGCCGGGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTTTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAACCGGTGGTCGCGCGCATTGGCCACCCGCGGCC
AAATTTCGTGCGCGGCGTCGGCATCACCCTGACCCTGGACGAAAGCCAGTTCATCGGCAGTGGCGTGTTT
CTGTTCGGCAAGGTGCTGGACCACTTCTTCGGCCAGTATTGCTCAATGAACAGCTTCACCCAGCTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTACAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A