SecReT6
Protein ID: 397695215
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2457
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2699682..2700164 [-]
Producthypothetical protein
NoteTssE
UniProt IDI7C954
KEGG IDppx:T1E_2457
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|397695215|ref|YP_006533096.1| hypothetical protein T1E_2457 [Pseudomonas putida DOT-T1E]
MSNQARLLPSLLDRLLDDRPYQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEELDGFSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2700164-2699682 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCCTACCAGTCGG
CCGAGCCCGCAGCGCAGCGCACCTGCTCGCTGGCCGAGTACAAGGCCAGCATCGTCCGCGACCTCGAAGT
CCTGGTGAACACCCGCCAGTCCCTGGTCGCCGAAGAGCTCGACGGCTTCAGCCAGCTCGGTGGTTCCATC
CTTGAATACGGCATGCCGGACTTCATCAGCCGCAGCGTGCTCGACCCGCACGATCGTCGCCTGATCCAGC
AACAGCTGGAGCGGGCGATCAGCACCGGAGACCGGCGCTTTCGCCGGGTCCGTGTTCAGCTGTTGGCCCA
GCAGAACGGCCATCGCATGTTGACCTTCCGCGTGGACGCCGTATTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA