SecReT6
Protein ID: 397695216
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2458
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2700191..2701693 [-]
Producthypothetical protein
NoteTssC
UniProt IDI7AZX8
KEGG IDppx:T1E_2458
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-196, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|397695216|ref|YP_006533097.1| hypothetical protein T1E_2458 [Pseudomonas putida DOT-T1E]
MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2701693-2700191 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCACCACAGC
CCTCGCTGCTCGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAACTGGTGAACCAGGTGCTCGAGGGTGAGATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGCATCGCCGAAATCGACGCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCC
GCGAGTTCCAGCAGTTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTAGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTGCGCGACCTGAAGGCCGCCAGCGAA
TTCGACCAGAGCGCACTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGCGCACCTTTCG
GCATGTTGATCGGTGACTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTCGAAGAGATCTCGCA
CGTCGCGGCGGCGGCGCACGCGCCGTTCATCTCGGCCGCTTCGTCCGAGCTGTTCGGCTGGGACTCGTTC
ACCGAGATGTCCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAAGACTCGCGCTACGTCGGCCTCACCCTGCCCCACGTGCTCGGTCGTCTGCCGTATGG
CCCGGATACCACCCCGGTGGAAGAATTCAACTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAATAC
CTGTGGATGAACGCCGCCTACGCCCTCGGCACCCGCGTCACCGACGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTGGAAGGCGGCGGCCTGGTCGAAGGCCTGCCGACCCATACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGACCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATCCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAACAGAAGCAGTACAACACCGACATCGCCAACGCCAACGCACGCCTGTCGGCCCAGCTGCAATACAT
CTTCGCCACTTCGCGCATCGCCCACTACATGAAGGCGATCATGCGCGACAAGATCGGCAGCTTTGCCTCG
CGCATGGATGTCGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTATGTGCTGCTCGACGACACCGCCAGCC
AGGAGGCCAAGGCCAAGTTCCCGCTGCGTGAAGCCCGCGCCGAGGTGTTCGAAGTGCCCGGCAAGCCAGG
CGTGTACAAGGCCGTGACCTACTTGCGCCCGCACTACCAGCTGGATGAACTGACCGCCTCGCTGCGGCTG
GTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA