SecReT6
Protein ID: 397695217
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2459
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2701708..2702247 [-]
Producthypothetical protein
NoteTssB
UniProt IDI7C5B0
KEGG IDppx:T1E_2459
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.00E-61, Aligned region: 11..165
Protein Sequence: 179 a.a.     [Download]
>gi|397695217|ref|YP_006533098.1| hypothetical protein T1E_2459 [Pseudomonas putida DOT-T1E]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFVYIDRDNF
NGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSDDRA
 
Nucleotide Sequence: 540 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2702247-2701708 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGGCGAAGAAGGAAAGCACTCAGCACAAACTCGACCGCGTTCGCGCGCCTCGGGTTCATATCACCTACG
ACGTGGACATCGGCGATGCCATCGAGAAAAAGGAGCTGCCCTTCGTCGTCGGCGTACTGGGTGATTTCTC
CGGCAACCCGCTGGAGCCGCTGCCCAAGCTCAAGGACCGCAAGTTCGTGTACATCGACCGCGACAACTTC
AACGGTGTGCTCAAGGGTATCAAGCCACGCTTGACCTACCGCGTCGACAACACCCTGGCCAAGAACGGCA
CCCAGCTGGGCGTGGAACTGAACTTCAACAGCCTCGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGT
CGAGCCGCTGCGCAAGCTGCTGGAAGTGCGCAACAAGCTGGCCGACCTGCGCAACAAGATGGGCGGCAAC
GACAAGCTCGAAGAGCTGCTGATGGATGTGCTGCAGAACACCGAAAAGCTCAAGACCTTGGGCAAGGAGT
TCGGCCGTGAAGCCGAAGTGAAAGACCCGTCCAGCGACGATCGCGCCTGA