SecReT6
Protein ID: 398352708
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28440
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2981696..2984002 [+]
Producthypothetical protein
NoteTssI
UniProt IDI3X6A9
KEGG IDsfd:USDA257_c28440
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.80E-76, Aligned region: 28..325
Phage_base_V [PF04717], Evalue: 8.00E-25, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 533..555
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 541..563
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 557..579
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 565..587
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 572..595
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 589..603
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 608..627
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 629..643
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 653..667
Gp5_C [PF06715], Evalue: 1.50E-09, Aligned region: 680..691
Protein Sequence: 768 a.a.     [Download]
>gi|398352708|ref|YP_006398172.1| hypothetical protein USDA257_c28440 [Sinorhizobium fredii USDA 257]
MSEDRKTFVQTPLDPAKLTFTHLLGYDEISRCFAFTVGFVSPDENVDPLKLLGKPISVEGESGDPKRWFS
GLVSDFRLIRIQEGLAYYEAEVRPWLWLLGNTTDCRIFQNMSVVEIAEEIFSKYKPAKFEKRLQGSYEAR
EYCVQYDETDLDFVQRLFEHEGIMYFFEYGDGEHTLILADAMNRLKPAPGYATVKFRAEGEPIRRDQEYI
TEWVATSSVHPATYAHTDYDFTKPAADLMAQSAQPFAHSQSRGEYYRHPGAHLTVGRGDSVAVVRREEIQ
AAHKRIAAAGTVRGLASGCTFKLEDFPRKDQNAEYLVLRADYRLFDPGYRPAAYADEETFRANLKVAPTS
LTYRPPRITPRPIMRGPQTATVVGPKGEEIFTDKYARVKVQFHWDRLGKKDQNSSCFVRVSQTWAGAGWG
FIQIPRIGQEVIIDFLEGDPDRPIITGRVYNGKEMPPYELPGNATQSGLKTNSSPGGGGWNELRFEDKAG
SEEVYFQAQKDNNLLIKNDRSKLVQHDQSDRIDNNAKHSVGVNLDEDVGNNKTTKVGVDRTVDIGSNDTE
TVGINRSLTVGADETISIGSNSTETIGSNHTQTVGIVQTVTVGAARIDSVGASETRTVGASQTNTIGTNR
SVSVGSSQSHDIGTSDSWEIGTDQSVQIGGGQTSEIGKGRSAKIGEDDATQIGGARSIKVAKSSLVEIGQ
DGGVNVGKKLVIEAGEAITIKTGSAMIVMKKDGTITIEGKDISVNAKGKFVGKASGEVSWKGSKINQN
 
Nucleotide Sequence: 2307 bp     [Download]
>gi|398349897|ref|NC_018000.1|:2981696-2984002 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGTCCGAAGACCGCAAGACATTCGTCCAGACGCCGCTCGATCCCGCGAAGCTGACCTTCACCCATCTGC
TCGGGTATGACGAAATCAGCCGCTGTTTTGCCTTCACCGTCGGGTTTGTCAGCCCCGACGAGAATGTCGA
TCCGCTGAAACTCCTCGGAAAACCAATCTCGGTCGAGGGAGAGTCCGGTGATCCGAAACGCTGGTTCAGT
GGGCTTGTTTCGGATTTTCGCCTGATCCGGATACAGGAAGGGCTTGCATATTACGAGGCGGAGGTGCGGC
CGTGGCTTTGGCTGTTGGGCAACACGACCGATTGTCGCATCTTTCAGAACATGAGTGTCGTGGAAATCGC
CGAGGAGATCTTCTCGAAATACAAGCCCGCCAAGTTCGAGAAGCGGTTGCAAGGTTCCTATGAGGCGCGG
GAATACTGCGTTCAGTATGACGAGACTGACCTGGACTTCGTGCAGCGCCTATTCGAGCACGAAGGCATCA
TGTATTTTTTCGAGTATGGCGACGGTGAGCACACTCTCATCCTTGCCGACGCTATGAACAGGCTGAAGCC
TGCCCCGGGTTATGCGACGGTCAAGTTCCGTGCCGAAGGCGAACCGATCCGACGGGACCAGGAATATATC
ACAGAGTGGGTAGCGACCAGTTCCGTCCACCCGGCCACCTATGCCCACACGGACTACGATTTCACCAAGC
CCGCCGCCGACCTGATGGCGCAATCGGCGCAGCCCTTTGCGCATTCGCAATCACGGGGAGAGTATTACCG
TCATCCCGGTGCCCACCTGACTGTAGGCCGCGGCGACTCCGTTGCCGTCGTAAGGCGAGAGGAAATTCAG
GCTGCGCACAAAAGGATCGCGGCCGCCGGCACTGTGCGTGGACTGGCTTCGGGTTGCACGTTCAAACTGG
AAGACTTCCCCCGCAAAGACCAAAACGCGGAATATCTAGTGCTTCGCGCCGACTACCGCCTTTTTGACCC
AGGCTACCGCCCCGCCGCCTATGCGGACGAAGAGACCTTCCGCGCGAACTTGAAGGTTGCGCCGACTTCG
CTGACTTATCGGCCACCGCGTATCACGCCTCGGCCGATCATGCGTGGTCCGCAAACGGCGACAGTCGTGG
GCCCCAAGGGTGAGGAAATCTTCACGGATAAATACGCTCGGGTGAAGGTGCAGTTTCACTGGGACCGTCT
TGGCAAGAAAGACCAGAACAGTTCCTGCTTCGTGCGGGTCTCGCAGACCTGGGCGGGCGCGGGCTGGGGG
TTCATTCAGATCCCGCGTATCGGCCAGGAGGTGATCATCGACTTCCTTGAGGGGGACCCGGACCGGCCGA
TTATCACTGGCAGGGTCTATAACGGCAAGGAAATGCCTCCCTACGAGCTACCGGGAAATGCAACCCAGTC
AGGGCTGAAGACGAATTCCTCACCTGGTGGGGGAGGCTGGAACGAACTGCGCTTTGAGGACAAGGCGGGA
TCGGAGGAAGTCTACTTCCAGGCGCAGAAGGACAACAACCTGCTGATCAAGAACGACCGCAGCAAGCTGG
TCCAGCACGACCAGTCGGACCGTATCGACAACAATGCCAAGCATTCTGTTGGTGTGAACCTCGATGAGGA
CGTCGGTAACAACAAGACGACGAAGGTCGGCGTCGACCGAACGGTCGATATCGGCTCCAACGATACCGAA
ACCGTTGGAATCAACCGCTCGCTTACGGTGGGCGCTGACGAAACGATCAGCATCGGCTCGAATTCCACCG
AGACGATCGGCTCAAATCACACCCAGACAGTTGGCATCGTCCAAACAGTCACTGTGGGGGCGGCACGCAT
CGACTCAGTCGGGGCCTCAGAAACCAGAACGGTAGGGGCCTCACAGACGAACACCATCGGCACGAACCGG
TCAGTGAGCGTGGGCAGCAGCCAAAGCCATGACATCGGTACGTCCGACAGCTGGGAAATCGGCACCGACC
AAAGCGTTCAGATCGGCGGCGGACAGACGAGCGAGATCGGCAAGGGCCGCAGCGCGAAAATCGGCGAGGA
CGATGCAACGCAGATCGGCGGAGCGAGATCGATAAAGGTCGCCAAGAGCAGCCTGGTCGAAATTGGTCAA
GACGGTGGCGTGAACGTCGGGAAGAAGCTGGTGATCGAGGCAGGCGAAGCAATTACCATCAAGACTGGCT
CAGCAATGATCGTAATGAAAAAGGACGGCACGATCACGATCGAAGGCAAAGATATTTCTGTCAACGCCAA
GGGCAAGTTTGTCGGCAAGGCTTCGGGCGAGGTCAGTTGGAAGGGCAGCAAGATCAATCAAAATTAG