SecReT6
Protein ID: 398352717
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28530
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2993031..2994350 [-]
Producthypothetical protein
NoteTssL
UniProt IDI3X6B8
KEGG IDsfd:USDA257_c28530
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.40E-55, Aligned region: 42..247
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 327..429
Protein Sequence: 439 a.a.     [Download]
>gi|398352717|ref|YP_006398181.1| hypothetical protein USDA257_c28530 [Sinorhizobium fredii USDA 257]
MASEDPFGLSEDQGRTRIRPPPAAKRIVPTGPLVRRARCHPNTLINAFATLLEFAPELENALPPGNPEAL
RTRLMEELVTARDAAVASGASLTRADAAAWAVASLLDDLALNTPWGGSSAWPRQPLVVMLRGDVDAGAQF
FARLEELERHPGRDRELLELHYFCLALGFRGKYRVPGRAGDRSLSAVRAAAARFLRDPDGESAPLSPRWE
GVMAADEPSRFAIPIWVLAVVAVVLATAIYVPLSMRLGAKAEELATLVRALPPPERAEIYRPNKRTPAPD
APSVQAVVFELLPEFRAAAPPALLSALKGNETASSVKLLLQSSNPELFQSARAELTKSFEPLVVSIAAVL
RDNAELIGSVTIVGHTDNVPLQATNPLSNNQRLSEARAATIAALLAANGVPTEHVRSEGRAATQPLARND
SREGRAANRRIELLIAKRL
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c2994350-2993031 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGGCAAGTGAGGACCCATTCGGCCTTTCGGAAGATCAAGGCCGTACGCGTATCCGCCCGCCGCCGGCCG
CCAAGCGGATCGTTCCCACCGGCCCGTTAGTGAGGCGGGCGCGATGCCATCCCAACACGCTGATCAATGC
TTTCGCTACGCTTTTGGAATTTGCGCCGGAACTCGAGAATGCGCTGCCGCCCGGCAATCCGGAAGCGCTG
AGAACAAGGCTCATGGAGGAGCTGGTAACTGCACGAGATGCGGCCGTTGCCTCCGGGGCAAGCCTTACAA
GGGCAGACGCGGCCGCCTGGGCTGTCGCTTCGCTTCTCGATGATCTGGCGCTCAACACACCATGGGGCGG
CTCCAGTGCGTGGCCTCGCCAGCCGCTCGTCGTCATGCTTCGAGGCGACGTGGATGCGGGTGCACAGTTC
TTCGCCCGGTTGGAAGAACTTGAGCGCCATCCCGGCCGCGATCGTGAATTGCTGGAGCTGCACTATTTCT
GCCTGGCGCTCGGCTTCCGGGGCAAATACCGCGTGCCGGGGCGTGCAGGTGATCGCTCCCTCAGCGCTGT
GCGAGCTGCAGCTGCCCGCTTCCTGCGGGACCCCGATGGCGAGAGTGCGCCGCTCTCGCCCAGGTGGGAG
GGCGTCATGGCAGCCGACGAACCTTCCCGCTTTGCCATTCCGATCTGGGTGCTCGCAGTCGTGGCGGTGG
TGCTTGCGACCGCGATTTACGTGCCGCTGTCCATGCGGCTGGGGGCCAAGGCGGAAGAACTAGCAACGCT
CGTTCGGGCACTGCCGCCGCCGGAGCGGGCCGAAATCTATCGCCCGAACAAGCGCACGCCGGCGCCGGAT
GCGCCATCGGTCCAAGCGGTCGTTTTCGAGCTTTTGCCCGAATTTCGCGCCGCCGCGCCTCCTGCCCTTC
TGTCAGCCCTGAAGGGCAATGAAACCGCCTCTTCTGTGAAACTCCTGCTTCAATCGAGCAATCCGGAGCT
CTTTCAGTCTGCACGGGCCGAACTGACGAAAAGCTTCGAACCGCTCGTCGTCTCTATTGCGGCTGTTCTC
AGGGATAATGCTGAATTGATCGGAAGTGTCACGATCGTCGGTCACACCGATAATGTTCCACTCCAGGCCA
CCAATCCGCTTTCAAACAATCAACGCCTCTCCGAGGCGCGCGCTGCTACGATTGCTGCTTTGCTGGCGGC
CAACGGCGTGCCAACTGAACACGTGCGATCGGAAGGACGTGCGGCAACGCAGCCCCTGGCCAGGAACGAT
AGTCGAGAAGGTCGAGCCGCCAATCGCAGGATCGAGCTCTTGATCGCAAAGAGGCTCTGA