SecReT6
Protein ID: 398352718
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28540
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2994355..2995689 [-]
Producthypothetical protein
NoteTssK
UniProt IDI3X6B9
KEGG IDsfd:USDA257_c28540
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.60E-108, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|398352718|ref|YP_006398182.1| hypothetical protein USDA257_c28540 [Sinorhizobium fredii USDA 257]
MTDANKVLWLEGLFLRTQHFQQQDRYNEALMRGSLQAGRLQTFGFRSLTLDATQLEAGRVAVSSARGIFP
DGTPFAIPETMDAPTPLAITNDMGAGAVQLALPLEPPGEASFDPAHREPTGARYRGRIEWIRDAVHGGAD
PEEIEIGRPQALLLSPAQATGGYTAMPVTSVNGLLADGSVAVAEYFLPPALTTGAVPFYGKLMQEVITGL
DRIADAHGKMVLGAAGRSVENLLVLDLANTARPRLAHMLPQEVFHPAELFLELSGLAGRMATYGSGSRRL
TELPTYEHMAPGPAFAALADTLRSLILSLRYVEPKSRALPVVKHSTNVWKVRIDNPELLTTSRIVVRVGC
DVSEEALRKIFVDQVTVGAADEFEALWKSRLPGIRLKPLHSQPREIPYDGDRLCLELDQRSEHWESLLRS
PGFVIGVSGILPSEPQVDCYSVSR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c2995689-2994355 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGACGGACGCTAACAAGGTGCTTTGGCTGGAGGGACTGTTCCTCCGGACGCAGCATTTCCAGCAGCAGG
ATCGTTATAACGAAGCCTTGATGCGAGGTTCGCTGCAGGCGGGTCGGCTTCAGACCTTTGGTTTCAGGTC
GCTCACGCTCGATGCCACGCAACTTGAAGCTGGACGGGTCGCCGTATCGTCAGCGCGTGGCATTTTCCCG
GACGGCACCCCATTCGCGATACCAGAAACAATGGACGCCCCCACACCTTTGGCAATCACGAATGACATGG
GCGCGGGGGCGGTGCAACTCGCTCTGCCACTGGAGCCCCCGGGCGAAGCCAGCTTCGATCCCGCTCACCG
CGAACCGACCGGAGCGCGTTATAGAGGGCGGATCGAGTGGATACGCGACGCAGTCCATGGCGGCGCCGAT
CCTGAAGAGATTGAAATTGGTCGACCGCAAGCCCTGCTCTTGTCGCCGGCTCAGGCGACTGGCGGCTACA
CGGCAATGCCAGTGACGAGCGTTAATGGACTGCTTGCTGATGGTAGTGTCGCGGTTGCTGAATACTTTCT
GCCTCCGGCGCTGACGACCGGTGCTGTGCCCTTCTACGGCAAGCTCATGCAGGAGGTAATCACTGGGCTT
GACCGCATTGCCGACGCACATGGCAAGATGGTGCTCGGCGCCGCCGGCCGCAGCGTGGAAAACCTGCTGG
TGCTCGATCTCGCCAATACGGCCCGACCGCGACTGGCCCATATGCTTCCACAGGAGGTCTTTCATCCGGC
CGAGCTGTTTCTTGAGCTCAGCGGACTGGCTGGCCGGATGGCGACATACGGATCAGGCTCCAGGCGGCTG
ACCGAGCTTCCCACCTACGAGCATATGGCACCCGGGCCGGCCTTTGCTGCGCTGGCAGACACCTTGCGAT
CGCTTATCCTGAGCTTGCGCTATGTCGAGCCGAAGTCGCGGGCGCTACCCGTTGTGAAGCATTCGACCAA
CGTTTGGAAGGTGCGCATCGACAACCCCGAACTGCTGACGACGAGCCGCATCGTTGTGCGCGTCGGGTGC
GACGTCTCAGAGGAAGCGCTCCGCAAGATCTTTGTCGACCAGGTGACCGTCGGTGCTGCGGACGAATTCG
AGGCACTGTGGAAATCCCGACTGCCAGGCATACGCCTCAAGCCTCTTCACTCGCAGCCGCGCGAAATCCC
CTATGACGGAGACCGTCTCTGTCTGGAGCTGGATCAACGCAGCGAGCATTGGGAATCGCTGCTGCGCTCG
CCGGGATTCGTAATTGGCGTTTCCGGTATCTTGCCCAGCGAGCCACAAGTCGACTGCTATTCGGTAAGCA
GGTAG