SecReT6
Protein ID: 398352719
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28550
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2995706..2996164 [-]
Producthypothetical protein
NoteTssJ
UniProt IDI3X6C0
KEGG IDsfd:USDA257_c28550
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.10E-27, Aligned region: 16..145
Protein Sequence: 152 a.a.     [Download]
>gi|398352719|ref|YP_006398183.1| hypothetical protein USDA257_c28550 [Sinorhizobium fredii USDA 257]
MLHRRDFLMVIGATGLISGCMSGPPKSSTVTVAAVGQAGMNLAADGGERPVTLLILRLKDVGKFNAADSF
ALQDPAATLGADLVGSDQITIAPGKSASKTVAFPPEATFLGLVALFREPGGRTWRRTAQIRPESTVTANV
TLNRGGMALALA
 
Nucleotide Sequence: 459 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c2996164-2995706 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGCTGCATCGACGCGACTTTCTCATGGTGATCGGCGCCACAGGCCTGATATCGGGCTGCATGAGTGGTC
CGCCCAAATCCTCAACCGTGACCGTCGCGGCGGTGGGGCAAGCGGGGATGAACCTGGCTGCTGACGGCGG
GGAGCGTCCGGTGACCCTGCTCATCCTCAGGCTCAAGGATGTCGGAAAGTTCAACGCTGCGGACAGTTTC
GCACTTCAAGATCCTGCCGCCACACTCGGCGCGGACCTCGTGGGGTCTGATCAAATCACCATCGCTCCAG
GCAAGAGCGCCTCAAAGACAGTCGCGTTTCCACCCGAAGCCACTTTCCTCGGTCTCGTCGCTCTGTTCCG
GGAACCTGGCGGTCGCACCTGGCGAAGAACCGCCCAGATCAGACCGGAATCGACGGTGACGGCGAACGTG
ACACTAAACCGCGGCGGTATGGCGCTCGCGCTCGCCTGA