SecReT6
Protein ID: 398352720
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28560
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2996164..2997411 [-]
Producthypothetical protein
NoteFha
UniProt IDI3X6C1
KEGG IDsfd:USDA257_c28560
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.80E-13, Aligned region: 26..94
Protein Sequence: 415 a.a.     [Download]
>gi|398352720|ref|YP_006398184.1| hypothetical protein USDA257_c28560 [Sinorhizobium fredii USDA 257]
MLTLTLEQSPRVQAVRQMRLVEGELVIGRSAEADWRIDDPDMYVSRAHCTIACVRGQYLVTDTSSGGLFI
DGSRTPLGPGNSAPLHDGSRLQLGGYVIRVDFQATPSERLSEQTASPPIGFEQDKFFSERSEPPPAPQRP
AGLPNPFEQPAETPDEGEAARQPPMFDDPFSLDPLPESSQHKQSFDFSWPSAPSQSPAFETQAAPPRAPE
QHAKPAPTIAAPSETELREAFLRGLGLSAGEFPTSDPVAQMENFGREYRMMLEGMMHLLRKRAEEKGEAR
IVQTVVGASDVNPLKFLPTADDVIATFLAQRSVGFLPPQAAISSSIRDLAHHHVRTWRGVQAALARMIER
FDPAALEGELKSLSAWDALLAGGRRAKLWELYENRYREIAKSATTRFLGEIGSDFRDGYEEREND
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c2997411-2996164 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGCTGACCCTTACTCTCGAGCAGTCACCCCGGGTGCAAGCTGTTCGCCAGATGCGACTGGTCGAGGGCG
AACTTGTCATCGGTCGCAGCGCTGAGGCCGATTGGCGTATCGACGATCCCGACATGTATGTCTCGCGGGC
TCATTGCACGATCGCGTGCGTTCGCGGTCAATATCTCGTGACGGACACCTCAAGCGGCGGCCTTTTCATA
GACGGGTCGCGAACACCGCTCGGGCCCGGGAATTCCGCCCCGCTGCATGATGGCTCACGCCTGCAACTCG
GCGGTTATGTCATCCGCGTCGACTTCCAAGCCACCCCCAGCGAGCGGCTTTCAGAACAGACGGCTTCTCC
GCCCATCGGTTTCGAGCAGGACAAGTTCTTCTCTGAGCGCAGCGAGCCGCCGCCGGCTCCCCAGCGACCG
GCCGGACTACCGAACCCGTTCGAACAACCGGCTGAAACCCCTGACGAAGGTGAGGCGGCAAGACAACCAC
CGATGTTTGACGATCCGTTCAGTCTTGATCCTCTACCGGAATCGAGCCAGCATAAGCAGTCCTTTGATTT
TTCGTGGCCGAGTGCACCATCGCAGTCTCCCGCCTTTGAAACACAGGCGGCGCCACCCCGCGCCCCGGAG
CAGCATGCGAAACCGGCGCCGACGATAGCGGCTCCCTCTGAAACGGAGCTTCGTGAAGCCTTCCTTCGCG
GATTGGGGCTGAGCGCCGGCGAGTTTCCGACATCCGACCCGGTCGCACAGATGGAGAATTTCGGCCGGGA
ATACCGCATGATGCTTGAAGGAATGATGCATCTCCTGCGCAAGCGTGCCGAAGAAAAGGGCGAGGCCAGG
ATCGTTCAGACGGTGGTTGGAGCGTCCGATGTTAACCCCCTCAAATTCCTGCCTACAGCGGACGATGTAA
TTGCGACGTTCCTGGCTCAACGCAGCGTCGGCTTTCTTCCTCCGCAGGCAGCGATCAGCAGCTCCATCCG
CGATCTCGCCCACCACCATGTAAGAACGTGGCGCGGCGTGCAGGCGGCGCTTGCGAGAATGATCGAGCGC
TTCGACCCAGCGGCTCTGGAAGGCGAACTGAAATCCCTTTCAGCGTGGGACGCCCTGCTGGCCGGTGGCC
GGCGGGCGAAACTCTGGGAGCTATATGAGAACCGCTATCGCGAAATTGCCAAGAGTGCGACGACGCGCTT
CCTGGGTGAGATCGGGAGCGACTTTCGGGACGGTTATGAAGAGAGGGAGAACGACTGA