SecReT6
Protein ID: 398352721
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28570
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2997405..2998472 [-]
Producthypothetical protein
NoteTssG
UniProt IDI3X6C2
KEGG IDsfd:USDA257_c28570
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-83, Aligned region: 20..326
Protein Sequence: 355 a.a.     [Download]
>gi|398352721|ref|YP_006398185.1| hypothetical protein USDA257_c28570 [Sinorhizobium fredii USDA 257]
MANDAGQSQPDLSKDARPLPTEFDFFELLRRLEEDGKLFGQSGRPDREPARLGQHVRLGFAVQDITEVEM
ATDKAAARVTVTNIGLLGPEGPMPLYLTRWVLDRLSQRWFATADMREISDTTFVDFVNVLQHRMIALFYR
AWADAHPSVQVGRPGGGRIRALSAALAGLGLSGPERHEPSAIDTAKLCHAPALANQVEGPERLTRFLADL
IKVPVRLREFVGTWIAIPTGLQSRLGNAHVRLAQSATIGPRSFQRQQRIELTLGPLTLQDYLAFLPGSER
RETLKRAIADLVGFGLDVDVRLVLKRDEIPPARLGEARIGHTAWVAPPKDRGDAEDLCMRTVNGWRPEML
EAATC
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c2998472-2997405 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGGCCAATGACGCCGGGCAATCGCAGCCTGATCTGAGTAAGGACGCCAGGCCACTCCCGACTGAGTTCG
ACTTCTTTGAGCTCCTGCGGCGCCTGGAAGAAGACGGGAAGCTTTTTGGCCAGTCGGGCCGACCAGATCG
GGAGCCGGCAAGGCTTGGACAACATGTGCGGCTCGGTTTTGCAGTGCAGGACATCACCGAAGTTGAGATG
GCAACCGACAAGGCGGCAGCCCGGGTTACGGTGACAAATATCGGATTGCTCGGGCCGGAAGGTCCGATGC
CCCTCTATCTGACACGTTGGGTACTGGATCGCCTTTCGCAGCGCTGGTTCGCCACGGCCGACATGCGGGA
GATCAGCGATACGACATTCGTCGACTTCGTGAATGTTCTTCAGCATCGAATGATTGCACTCTTTTATCGG
GCATGGGCGGACGCTCATCCATCAGTGCAGGTCGGGCGTCCGGGCGGCGGGCGCATTCGCGCGTTATCGG
CGGCACTGGCCGGGCTCGGCCTCAGTGGACCAGAACGCCATGAGCCCTCAGCGATCGATACCGCCAAGCT
ATGTCACGCGCCTGCGCTTGCTAATCAAGTAGAAGGGCCCGAAAGGCTCACTCGATTTCTTGCCGACCTC
ATAAAGGTCCCGGTTCGGCTTAGGGAGTTTGTCGGCACCTGGATCGCGATACCAACAGGGCTCCAATCCC
GCCTTGGGAACGCCCATGTTCGACTTGCCCAAAGCGCCACAATCGGGCCTCGCTCATTCCAGCGGCAGCA
AAGAATCGAGCTCACCTTGGGGCCCTTGACGCTTCAAGACTACCTGGCTTTCCTCCCCGGCAGCGAACGG
CGCGAAACCTTGAAAAGGGCGATCGCCGACTTGGTTGGATTCGGACTCGACGTCGATGTCAGGCTCGTGC
TCAAGCGAGACGAAATTCCTCCGGCACGACTGGGGGAAGCGAGGATTGGACACACGGCGTGGGTCGCTCC
ACCCAAAGATCGAGGTGACGCAGAAGACCTGTGCATGCGCACGGTCAATGGCTGGCGGCCCGAAATGCTG
GAGGCTGCGACATGCTGA