SecReT6
Protein ID: 398352722
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28580
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2998436..3000310 [-]
Producthypothetical protein
NoteTssF
UniProt IDI3X6C3
KEGG IDsfd:USDA257_c28580
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-164, Aligned region: 5..624
Protein Sequence: 624 a.a.     [Download]
>gi|398352722|ref|YP_006398186.1| hypothetical protein USDA257_c28580 [Sinorhizobium fredii USDA 257]
MDRVFLEYYEEELTHIRALAAEFADMHPSIARNLSLDTVPCPDPYVERLLDGVAYLAARTRQKVDAESAR
FARSVLENFYPDLVCPAPATGMALLKPGQQVQTMAAGHLVRRGTRLVSSARPGISTRCIYTTAQDVMLWP
LAIASVTYIQDRSALAAAGIAPIGGQSGAAALSIVFGRTGKGRLSDLSLDRLDLYFAEKSKAPLLFDTLF
GVCSATGARPEGRDNPLSALAEPEMVGISDDEALLPRTRETFEGYRLLREYFVAPERFHYVRIKGLQAVV
RRCGAGLELVFLLRRPVPELANIAATDFELFATPIINLFERSCNVIELDQRRTRQVLHADRTRPGDFEIH
RAIRVEDADAGGPDAEIPALFSLGQNRGNGWVYFTERRPRRPNEDELRQGQTRTSYVGDDVFVTLSRPAH
SKAARPLKRLEVTALCTNRDLPILDDTPSLSLESGDPVETIRLLGAVRPPVPSIPATLPAGAVDATRADE
LAWRFVAQLSLNFLSLAEEGRGVDPLHALLDLYAQRGDPSLSRHLRAIARIESRSVIERLPIPGPMCFAR
GTEVTLHIDQSVLAGHSALLLSGLLSKLFARYASINAFVRTRARVIQKQEDVPWPMTPGNRSLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c3000310-2998436 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGGACCGAGTCTTCCTGGAATATTACGAGGAAGAACTCACACATATCCGCGCTCTCGCCGCCGAGTTTG
CGGACATGCATCCTTCGATCGCCCGCAACCTTTCCCTGGACACGGTCCCCTGTCCCGATCCTTATGTCGA
ACGCCTGCTCGACGGCGTCGCCTATCTCGCCGCGCGCACCCGCCAAAAAGTGGATGCGGAGAGCGCGCGT
TTTGCCCGAAGCGTGCTCGAGAATTTCTATCCCGATCTTGTTTGCCCGGCGCCGGCAACCGGCATGGCAT
TGCTGAAGCCCGGCCAGCAGGTTCAAACAATGGCTGCGGGGCACCTCGTTAGGCGGGGGACGCGGCTCGT
TTCGAGCGCCCGCCCTGGAATTTCGACGCGATGCATCTATACCACGGCACAGGATGTGATGCTCTGGCCG
CTTGCGATCGCCTCGGTCACCTACATCCAGGATCGAAGCGCACTTGCAGCAGCGGGAATAGCTCCGATCG
GCGGACAATCCGGCGCCGCTGCATTGAGCATCGTCTTCGGTCGAACCGGCAAAGGCAGGCTCAGCGATTT
GTCGCTCGATCGCCTTGATCTTTATTTCGCTGAAAAAAGCAAGGCGCCCTTGCTCTTCGATACGCTTTTT
GGCGTCTGTTCCGCCACCGGCGCTCGCCCGGAAGGCCGCGATAATCCGCTGAGCGCACTGGCCGAGCCGG
AGATGGTCGGAATCTCGGATGACGAGGCGCTGCTACCGCGCACGCGCGAAACTTTTGAAGGCTATAGGCT
TTTGCGCGAATACTTTGTCGCGCCAGAGAGATTCCACTACGTACGTATCAAAGGACTGCAGGCAGTGGTT
CGTCGCTGTGGGGCTGGGCTCGAACTGGTGTTTCTCTTGCGACGTCCCGTCCCCGAGCTCGCCAATATCG
CAGCAACTGATTTCGAACTTTTCGCAACGCCGATCATCAATTTGTTCGAACGCAGCTGCAATGTCATCGA
ACTCGACCAGAGGCGCACACGGCAGGTGCTCCATGCCGACCGGACCCGCCCAGGCGATTTCGAAATCCAT
CGCGCAATCCGTGTCGAAGACGCTGACGCCGGGGGCCCGGACGCCGAGATACCGGCGCTCTTCAGCTTGG
GCCAAAATCGTGGAAATGGCTGGGTATATTTTACCGAACGCCGCCCGCGGCGACCGAACGAGGACGAGCT
GCGCCAGGGACAAACGCGAACGTCCTACGTTGGTGACGATGTCTTCGTCACGCTTTCGCGTCCAGCCCAC
TCGAAGGCGGCACGGCCCCTGAAACGGCTCGAGGTGACGGCGCTTTGCACCAATCGTGACCTGCCGATCT
TGGACGACACACCGTCGCTCTCCCTCGAGAGCGGCGATCCGGTCGAGACTATTCGGCTTCTCGGAGCGGT
GCGGCCGCCGGTGCCCTCAATTCCGGCCACGCTCCCGGCTGGCGCTGTGGATGCCACGCGAGCCGATGAA
CTTGCCTGGCGGTTTGTGGCGCAGCTCTCGCTCAATTTTCTCAGCCTGGCAGAAGAAGGCCGCGGGGTGG
ACCCGCTTCACGCCCTGCTTGATCTTTACGCCCAACGCGGCGATCCAAGCCTCAGCCGGCACTTACGCGC
GATTGCCAGAATTGAGTCTCGGTCTGTGATCGAGCGCCTCCCCATTCCTGGGCCGATGTGCTTTGCGCGT
GGCACCGAGGTTACGCTTCATATCGACCAGTCAGTGCTTGCCGGGCATAGCGCATTGCTACTCTCCGGCC
TGCTTTCGAAGCTTTTTGCCCGCTATGCGTCAATCAATGCGTTCGTGCGAACGCGCGCGCGTGTGATACA
GAAGCAGGAGGATGTGCCATGGCCAATGACGCCGGGCAATCGCAGCCTGATCTGA