SecReT6
Protein ID: 398352723
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28590
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]3000312..3001079 [-]
Producthypothetical protein
NoteTssE
UniProt IDI3X6C4
KEGG IDsfd:USDA257_c28590
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.30E-24, Aligned region: 111..235
Protein Sequence: 255 a.a.     [Download]
>gi|398352723|ref|YP_006398187.1| hypothetical protein USDA257_c28590 [Sinorhizobium fredii USDA 257]
MSMSASETWQKRLGREARPPGGHLRATREAIQPSLWDRLVNDLPGLSSEIKQLRQALQNDIDGERLDALV
AGGIRQIDAATDTSAEQKKSLHRLVSLERRRAELESRGVVVSTDVLREAVRRDIEALFNAQRFESSPLLT
DFEADQIRDNPPSLEDFPEVRRSVVNYGVPPFSGRSSRDFDRDELAKEIRSVLAAFEPRLKESATKVTVS
LGDRATGLRIDIDALLLTSPAPERLRLRTFLDLENGSARTELKDT
 
Nucleotide Sequence: 768 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c3001079-3000312 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGTCTATGTCGGCAAGTGAAACCTGGCAAAAACGGTTGGGAAGGGAAGCGAGACCGCCCGGGGGGCACC
TGCGGGCGACTCGCGAAGCGATCCAGCCATCCTTGTGGGATCGCCTGGTCAATGACCTGCCGGGGCTAAG
CTCGGAAATCAAGCAACTTCGGCAGGCTTTACAGAACGATATAGACGGCGAACGTCTCGATGCGCTGGTT
GCCGGTGGCATTCGCCAAATCGACGCCGCTACAGATACCAGCGCCGAGCAAAAGAAGAGTTTGCACCGTC
TGGTCTCGTTGGAGCGGCGTCGGGCAGAACTGGAAAGCCGCGGCGTCGTCGTCTCGACCGATGTGTTGCG
TGAAGCAGTTCGGCGAGACATCGAGGCGCTGTTTAATGCGCAACGCTTCGAATCCTCGCCACTCTTGACG
GACTTCGAGGCGGATCAGATTCGCGACAACCCTCCCTCGCTTGAGGATTTTCCGGAGGTTCGTCGCAGCG
TGGTCAATTACGGCGTGCCGCCCTTCTCCGGCCGATCATCTCGCGATTTCGACCGTGATGAACTGGCGAA
GGAAATCAGAAGCGTGCTCGCGGCATTTGAACCTCGGCTAAAGGAAAGCGCGACGAAAGTGACCGTCAGT
CTCGGCGACAGAGCCACTGGTCTGAGGATCGACATCGACGCCCTGCTGCTCACCTCGCCGGCACCCGAGC
GGCTACGGCTTCGAACTTTTCTCGATCTCGAGAACGGTTCGGCACGCACCGAGCTCAAGGACACCTGA