SecReT6
Protein ID: 398352724
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28600
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]3001060..3001509 [-]
Producthypothetical protein
NoteTssD
UniProt IDI3X6C5
KEGG IDsfd:USDA257_c28600
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-28, Aligned region: 6..135
Protein Sequence: 149 a.a.     [Download]
>gi|398352724|ref|YP_006398188.1| hypothetical protein USDA257_c28600 [Sinorhizobium fredii USDA 257]
MKIDGFLKVPDIPGPSIRDGHEEEIEVHGVEFEMQAPFDPNSLSRRGRVSLGMVNFIKNYDKSSPYLKKA
LFDNTLLDEVTFSARRTIEGETSDYLVVTLKDASVTSYVMKPSEDEPDLIEERVGFAYKNINFKYDDKDE
VEMDVYVGK
 
Nucleotide Sequence: 450 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c3001509-3001060 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGAAAATTGATGGATTTCTAAAGGTCCCCGACATTCCGGGGCCAAGCATCCGCGATGGCCACGAAGAAG
AGATCGAAGTGCACGGAGTAGAGTTTGAAATGCAAGCTCCCTTCGATCCCAATTCATTATCGAGGAGGGG
CCGCGTCAGCTTGGGCATGGTCAATTTCATTAAAAACTACGACAAGTCTTCGCCCTACCTGAAAAAGGCT
CTCTTCGACAACACGCTCCTGGACGAAGTCACGTTTTCGGCACGAAGAACGATCGAAGGCGAGACAAGCG
ATTATCTGGTCGTAACCTTAAAGGATGCATCGGTAACCAGCTACGTAATGAAGCCAAGTGAGGACGAGCC
AGACCTCATCGAAGAGCGCGTCGGATTCGCTTACAAGAACATCAATTTCAAGTACGACGATAAGGACGAG
GTCGAGATGGATGTCTATGTCGGCAAGTGA