SecReT6
Protein ID: 398352725
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28610
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]3001539..3003047 [-]
Producthypothetical protein
NoteTssC
UniProt IDI3X6C6
KEGG IDsfd:USDA257_c28610
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-178, Aligned region: 69..498
Protein Sequence: 502 a.a.     [Download]
>gi|398352725|ref|YP_006398189.1| hypothetical protein USDA257_c28610 [Sinorhizobium fredii USDA 257]
MAEQEKATAAGVAQAEGVDLGEFSELLEKDFKVKKDDSEKLQVLVQNLALAARSRSESTVISSNAIKSIK
SLISGIDKLLTEQVNHILHAPEVLQMEGTWRGLWYLVNNTETDQKLKIRVMNISKEDLADTLEDYEGQMW
DQSPIFKKVYTDEYSMLGGNPYGCLIGAYEFSNHPKDVALLRNMSGICASAHTPFIAAASPRLFRMESWQ
ELPNPQDLQQIVSSTAYASWQSLRESEDSRYIGLTMPRVLARLPYGAETVPVKGFAFEEEVHGDHHRYVW
MNAAFPMGVNINRSHKLFGWGTQIRGVENGGAVINLPVHTFPTDDGTVAMKCPTEVAIDDRREAELAKLG
LMPILHRKNTDIAAFIGAHSLQDDETRAGRLVDPDAQANERLSANLPYLFPVSRFAHYLKAIARDKIGSF
KERADMQIWLTEWINRYVLANPAFADEKARAKRPLAAAEVQVDSVEGRPGWYNARFYLRPHYQLEGINAS
LRLVSELPSMKS
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c3003047-3001539 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGGCCGAACAGGAAAAAGCCACCGCTGCTGGTGTCGCGCAAGCGGAGGGAGTCGATCTGGGGGAATTCA
GCGAGCTTCTGGAAAAGGACTTCAAGGTCAAGAAGGATGATAGCGAGAAGCTTCAAGTCCTGGTGCAAAA
TCTGGCGCTTGCCGCGCGATCACGCTCGGAATCCACTGTCATCTCATCGAACGCGATCAAGTCGATCAAG
TCCTTGATCTCCGGCATCGACAAGCTTCTGACCGAGCAGGTCAACCATATCCTTCATGCGCCGGAAGTGC
TCCAGATGGAAGGAACGTGGCGCGGGCTGTGGTACCTCGTCAACAATACCGAGACGGATCAAAAACTGAA
GATCCGCGTCATGAATATTTCGAAGGAGGACCTGGCCGATACTCTCGAGGATTACGAAGGCCAGATGTGG
GATCAGAGTCCCATCTTCAAGAAAGTCTATACCGACGAATACTCGATGCTCGGTGGAAACCCGTATGGAT
GCCTGATAGGCGCCTACGAGTTCTCAAATCACCCGAAGGATGTCGCTCTCCTTCGCAACATGTCCGGCAT
CTGCGCGTCGGCACATACTCCCTTCATTGCAGCCGCTTCCCCACGTCTGTTTCGCATGGAGAGCTGGCAG
GAACTGCCGAACCCGCAAGACCTGCAACAGATCGTGTCGTCAACAGCCTATGCGTCATGGCAGTCACTGC
GCGAGAGTGAGGACTCGCGGTATATTGGGCTAACCATGCCCCGAGTGCTGGCGAGACTGCCCTATGGCGC
AGAAACGGTCCCTGTGAAGGGTTTCGCCTTCGAGGAAGAAGTCCACGGCGACCATCACCGATATGTCTGG
ATGAATGCGGCCTTCCCGATGGGAGTGAACATAAACCGCAGTCATAAGCTCTTCGGCTGGGGCACCCAAA
TTCGAGGTGTCGAGAACGGCGGCGCAGTCATCAATCTCCCGGTCCACACCTTTCCGACCGATGACGGCAC
GGTAGCGATGAAGTGCCCCACCGAGGTCGCGATCGATGACCGGCGCGAGGCTGAGCTCGCCAAGCTCGGG
CTGATGCCGATCCTTCATCGCAAGAACACCGATATTGCCGCCTTCATCGGTGCCCATTCGCTGCAGGACG
ATGAGACGCGAGCGGGCCGGCTGGTCGATCCGGACGCTCAGGCCAATGAGAGGTTGAGCGCGAACCTGCC
CTATCTGTTCCCGGTTTCCCGTTTCGCCCACTATTTGAAGGCGATCGCCAGGGACAAGATCGGCTCATTC
AAGGAACGCGCAGACATGCAGATCTGGCTGACGGAGTGGATCAATCGCTACGTTCTGGCCAATCCTGCCT
TCGCCGATGAAAAGGCCCGCGCAAAGCGGCCTCTGGCGGCCGCCGAAGTTCAGGTTGACAGCGTAGAGGG
CCGGCCGGGCTGGTACAATGCCCGGTTCTACCTGCGACCACATTACCAGTTGGAAGGCATCAATGCTTCG
CTCCGGCTCGTTTCGGAGCTGCCGTCTATGAAGTCGTGA