SecReT6
Protein ID: 398352726
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28620
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]3003051..3003587 [-]
Producthypothetical protein
NoteTssB
UniProt IDI3X6C7
KEGG IDsfd:USDA257_c28620
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-52, Aligned region: 9..169
Protein Sequence: 178 a.a.     [Download]
>gi|398352726|ref|YP_006398190.1| hypothetical protein USDA257_c28620 [Sinorhizobium fredii USDA 257]
MSETKAKVIERNRAPRVQIAYEVETYGSPTTIELPFVMGVMADLAGASETPEARKSVRDRTFVETDANRF
GRFMEALSPRVKARVKNTLPQPPGEERDEELAVDLTFTSIADFTPDRVAEQVPQLAELLRMRRQLEELLG
FMDGRIDAEKRIAQLLNNEPLIAKIADQAIDDSSKSEV
 
Nucleotide Sequence: 537 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c3003587-3003051 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGAGCGAAACTAAGGCGAAGGTAATTGAACGAAACCGGGCGCCTCGCGTCCAGATCGCCTATGAAGTGG
AAACATACGGCAGCCCGACGACGATCGAATTGCCGTTTGTGATGGGCGTGATGGCTGATCTGGCCGGCGC
CTCCGAGACACCAGAGGCGCGCAAGTCCGTACGGGACCGCACGTTTGTCGAGACCGACGCAAACAGGTTC
GGCCGTTTCATGGAAGCGCTCAGCCCCCGCGTCAAAGCTCGGGTGAAGAACACTCTGCCCCAGCCTCCGG
GCGAAGAACGCGATGAAGAGCTTGCGGTAGACCTTACCTTTACGAGCATCGCCGACTTCACGCCGGATCG
TGTTGCCGAACAAGTCCCGCAGCTTGCCGAGCTTTTGAGGATGCGCCGCCAGCTTGAGGAACTGCTAGGT
TTCATGGATGGTCGCATCGACGCCGAAAAACGCATCGCGCAGCTTTTGAACAATGAGCCCCTCATTGCAA
AGATCGCAGACCAGGCGATCGACGATAGCAGCAAATCGGAGGTCTGA