SecReT6
Protein ID: 398352727
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28630
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]3003591..3004739 [-]
Producthypothetical protein
NoteTssA
UniProt IDI3X6C8
KEGG IDsfd:USDA257_c28630
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-16, Aligned region: 57..116
Protein Sequence: 382 a.a.     [Download]
>gi|398352727|ref|YP_006398191.1| hypothetical protein USDA257_c28630 [Sinorhizobium fredii USDA 257]
MFDSALWLSPLNGNNPSGESLRNDGRFHELERLMQPQIEISRDERNNPVERAEVPVDWTNVLHKSEELRQ
HGRDLRLLVIVTRALANEQSFAGLASGLNLIARTFDLHWETMHPELRRDSPPRDAALRRTNALLQLQNDK
DGLLGDLRRMTFFAPHGVGPFTGRDLERGSIDTRTALSEAAPGLSQAEKSSLVSEHDRLLDRMRIGCAAF
AEQSSSEAAELVAHARSAATALAELEASLNRQMGGDVRFTLSDLGRFLQRVISTLERAQPGSRPEIASEE
GVVREKVTPQAISGADSSHIATAAVFPSRLASREDVTRCIDLVIDFYDRTEPSSPIPHLARRIKRMVPMN
FLELMEDLAPSGLKEFRLLAGMPENKKSRDER
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c3004739-3003591 Sinorhizobium fredii USDA 257 chromosome, complete genome
TTGTTCGACTCCGCTCTCTGGCTAAGTCCACTGAATGGCAATAACCCCTCTGGCGAAAGCTTGCGGAATG
ATGGGCGATTCCACGAACTGGAACGCCTTATGCAACCTCAAATCGAGATCAGCCGAGACGAACGCAACAA
TCCCGTAGAAAGGGCCGAAGTACCTGTCGACTGGACAAACGTTCTTCATAAATCTGAGGAGTTGCGTCAG
CACGGGCGGGATTTGCGGCTCCTGGTGATCGTGACTCGAGCCCTTGCAAATGAACAGAGTTTTGCCGGAT
TGGCCTCGGGACTTAACCTGATCGCTCGGACTTTCGACCTGCATTGGGAGACGATGCATCCAGAACTTCG
GCGGGATTCCCCGCCTCGGGATGCGGCCCTGCGCCGGACCAACGCACTTCTCCAGCTGCAAAACGACAAG
GATGGGTTATTGGGCGACCTTCGGAGGATGACCTTTTTTGCGCCCCATGGTGTTGGCCCCTTCACCGGCC
GGGATTTGGAGCGCGGATCGATCGACACCCGAACCGCTCTTAGCGAGGCTGCACCTGGGCTGAGCCAGGC
CGAGAAGTCGTCACTCGTAAGCGAGCATGACCGCTTATTGGATCGCATGAGAATAGGCTGCGCGGCATTT
GCGGAACAATCCTCGAGCGAAGCGGCCGAGCTTGTCGCCCATGCTCGTAGTGCGGCCACTGCACTGGCGG
AGCTCGAAGCATCGCTCAACCGGCAGATGGGCGGTGATGTGCGCTTCACACTGTCGGATTTGGGACGGTT
CCTTCAGCGCGTGATTTCGACGCTCGAGCGAGCGCAACCCGGCTCCCGGCCGGAGATCGCAAGCGAGGAA
GGCGTCGTTCGCGAGAAGGTAACTCCACAAGCGATCTCCGGCGCGGATTCGAGCCACATCGCAACTGCGG
CAGTCTTTCCGTCGCGGCTTGCCTCGCGCGAGGATGTCACAAGGTGCATCGACCTCGTCATTGATTTCTA
CGACCGCACGGAGCCGTCAAGCCCCATCCCTCATCTGGCGCGCAGAATCAAACGCATGGTGCCGATGAAT
TTTCTGGAACTCATGGAGGATCTGGCGCCCTCCGGTCTAAAGGAGTTCCGGCTTTTGGCCGGCATGCCAG
AAAACAAGAAATCTCGGGACGAAAGGTGA