SecReT6
Protein ID: 398352729
SecReT6 ID669
T6SS typei3
Gene symbolclpV
Locus tagUSDA257_c28650
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]3007099..3009831 [+]
Productprotein ClpV
NoteTssH
UniProt IDI3X6D0
KEGG IDsfd:USDA257_c28650
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 230..333
AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 642..808
AAA [PF00004], Evalue: 3.80E-20, Aligned region: 230..362
AAA [PF00004], Evalue: 3.80E-20, Aligned region: 648..732
AAA_16 [PF13191], Evalue: 4.90E-13, Aligned region: 207..253
AAA_16 [PF13191], Evalue: 4.90E-13, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 4.90E-13, Aligned region: 506..506
AAA_16 [PF13191], Evalue: 4.90E-13, Aligned region: 616..692
AAA_16 [PF13191], Evalue: 4.90E-13, Aligned region: 711..729
AAA_16 [PF13191], Evalue: 4.90E-13, Aligned region: 807..841
AAA_5 [PF07728], Evalue: 1.00E-12, Aligned region: 230..250
AAA_5 [PF07728], Evalue: 1.00E-12, Aligned region: 647..761
ClpB_D2-small [PF10431], Evalue: 1.50E-10, Aligned region: 815..889
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 229..316
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 343..390
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 646..680
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 230..255
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 645..669
Sigma54_activat [PF00158], Evalue: 2.90E-06, Aligned region: 216..244
Sigma54_activat [PF00158], Evalue: 2.90E-06, Aligned region: 647..746
Zeta_toxin [PF06414], Evalue: 9.00E-06, Aligned region: 230..251
Zeta_toxin [PF06414], Evalue: 9.00E-06, Aligned region: 468..496
Zeta_toxin [PF06414], Evalue: 9.00E-06, Aligned region: 639..687
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 216..252
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 647..667
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 819..847
AAA_17 [PF13207], Evalue: 2.60E-05, Aligned region: 230..272
AAA_17 [PF13207], Evalue: 2.60E-05, Aligned region: 646..682
AAA_14 [PF13173], Evalue: 2.70E-05, Aligned region: 230..310
AAA_14 [PF13173], Evalue: 2.70E-05, Aligned region: 646..728
AAA_25 [PF13481], Evalue: 5.40E-05, Aligned region: 212..290
AAA_25 [PF13481], Evalue: 5.40E-05, Aligned region: 645..673
AAA_25 [PF13481], Evalue: 5.40E-05, Aligned region: 826..868
Arch_ATPase [PF01637], Evalue: 8.90E-05, Aligned region: 209..250
Arch_ATPase [PF01637], Evalue: 8.90E-05, Aligned region: 281..384
Arch_ATPase [PF01637], Evalue: 8.90E-05, Aligned region: 645..668
Arch_ATPase [PF01637], Evalue: 8.90E-05, Aligned region: 713..729
NACHT [PF05729], Evalue: 0.00031, Aligned region: 230..257
NACHT [PF05729], Evalue: 0.00031, Aligned region: 647..674
NACHT [PF05729], Evalue: 0.00031, Aligned region: 843..878
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 230..250
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 648..678
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 222..247
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 645..672
TSKS [PF15358], Evalue: 0.0055, Aligned region: 431..516
RNA_helicase [PF00910], Evalue: 0.0071, Aligned region: 231..251
RNA_helicase [PF00910], Evalue: 0.0071, Aligned region: 648..669
RNA_helicase [PF00910], Evalue: 0.0071, Aligned region: 745..766
TIP49 [PF06068], Evalue: 0.0081, Aligned region: 230..251
TIP49 [PF06068], Evalue: 0.0081, Aligned region: 278..310
TIP49 [PF06068], Evalue: 0.0081, Aligned region: 646..683
Hpr_kinase_C [PF07475], Evalue: 0.009, Aligned region: 230..242
Hpr_kinase_C [PF07475], Evalue: 0.009, Aligned region: 644..666
Protein Sequence: 910 a.a.     [Download]
>gi|398352729|ref|YP_006398193.1| protein ClpV [Sinorhizobium fredii USDA 257]
MQPNMSSPSFKRKELVGKLNPVCLRAFKAAADAAKLRGNPYVELVHWIEQLALVDRADFQLILRDAGVDL
GRLAADMARAIDKLPYGATSIEEFSDHIFHAIQEAWSLASLQFGSEEVRGAFVLIASRKLPVLDGLLSKI
SVEFDRIDADSVIARFDDVLAGSLESTRREETPEPSRKRRPSGAESALAKYAVDLTRRARDGKIDPVLGR
DPEIRQIIDILMRRRQNNPILTGEAGVGKTAVVEGFALRLAADDVPPPLKEVSLHMLDIGLMQAGASVKG
EFERRLKTIIDEVQASETPIILFIDEAHTLIGAGGAAGTGDAANLLKPVLARGELRTVAATTWAEYKQYI
EKDPALTRRFQVVKVEEPDEEGAVLMLRGVAGVLEKHHQVQILDEAIETAVSLSHRYIPARQLPDKAVSL
LDTACARVAVSQHATPAEVEDLLRRKQSLEIEEAIIGREGAIGIEIEDRQAKVAAALAETESALLAAKAR
WEKEQAMVSEILDLRARLRGKGVELDHALADGAAGDQAAATPIVDEPASGASEGAIADQNSDLVRLKTLM
AELADAQGETPLILLSVDRNAVASVVQDWTGIPVGRMLTSQTEKALQLANVLSERVVGQDIAMESIARRV
QTSRAGLGSPEKPVGVFLLCGPSGVGKTETALALAEALYGGEQNLISINMSEFQEAHTVSTLKGAPPGYV
GYGKGGVLTEAVRRRPYCVILLDEVEKAHPDVHEIFFQVFDKGMMDDSEGRRIDFRNTLILLTSNVGSDA
IMKLTDGGRMRPPPEELEAVLRPQLLKVFPPAFLGRVIVIPYYPLSDAMIEAITRHHFGKIARRLRASHD
AELVIEDGVRELVKARCTEVESGGRMIDAILTNTLLPALSKGVLNWSLEGKRLTKVTVGASEEGFTYSFE
 
Nucleotide Sequence: 2733 bp     [Download]
>gi|398349897|ref|NC_018000.1|:3007099-3009831 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGCAGCCGAACATGTCTTCTCCAAGCTTCAAGCGCAAGGAACTGGTCGGCAAGCTCAACCCCGTTTGCC
TGCGTGCGTTCAAGGCGGCGGCGGACGCGGCCAAGCTTCGCGGCAATCCCTATGTTGAACTCGTTCACTG
GATCGAACAACTGGCACTTGTCGACCGTGCCGATTTTCAGTTGATCCTGAGAGATGCCGGCGTGGATCTC
GGCCGCCTCGCCGCCGACATGGCAAGGGCGATAGACAAACTACCCTATGGCGCGACCTCGATCGAGGAGT
TTTCCGACCACATCTTTCACGCCATCCAGGAGGCGTGGAGCCTCGCCAGCCTGCAGTTCGGATCCGAAGA
GGTGCGTGGAGCCTTTGTCCTCATAGCCTCAAGGAAGTTGCCCGTGCTGGACGGGCTTTTATCGAAGATC
AGCGTTGAATTCGATCGGATCGATGCAGACTCCGTCATCGCCCGGTTTGACGACGTCCTTGCTGGATCAC
TTGAAAGTACCCGCAGGGAAGAGACTCCCGAACCATCCCGGAAAAGACGCCCCTCAGGGGCTGAGTCCGC
ATTGGCGAAATATGCCGTGGACCTCACTCGACGTGCACGCGACGGAAAAATTGACCCGGTTCTGGGCCGC
GACCCAGAGATACGGCAGATCATCGACATCCTCATGCGTCGCAGACAGAACAACCCGATCCTGACGGGCG
AAGCCGGTGTGGGTAAAACCGCGGTCGTCGAAGGCTTTGCTCTGCGCCTTGCCGCAGACGATGTGCCGCC
GCCGCTCAAAGAGGTGTCGCTTCACATGCTCGACATCGGCTTGATGCAGGCGGGGGCGAGCGTCAAAGGT
GAGTTCGAAAGGCGGCTGAAGACAATTATCGATGAAGTTCAGGCATCGGAAACACCCATTATTCTTTTCA
TCGACGAAGCTCACACTCTGATCGGGGCAGGCGGTGCAGCGGGAACAGGAGACGCCGCAAATCTTCTTAA
ACCCGTATTGGCGCGCGGCGAGCTTCGCACGGTCGCTGCAACGACCTGGGCCGAATACAAGCAGTACATT
GAGAAAGACCCCGCTTTGACGCGACGTTTCCAGGTGGTCAAGGTCGAAGAGCCCGATGAAGAGGGCGCCG
TCTTGATGTTGCGCGGTGTGGCAGGCGTGTTGGAGAAGCACCATCAGGTGCAGATTCTCGACGAGGCGAT
CGAGACGGCCGTCAGCCTTTCGCATCGCTATATCCCGGCGCGCCAACTGCCCGACAAGGCGGTCAGCCTC
CTCGATACCGCATGCGCGCGCGTGGCTGTATCGCAGCACGCCACGCCGGCGGAAGTCGAAGACCTTCTGC
GACGCAAGCAGTCTCTTGAGATCGAAGAGGCGATCATCGGGCGCGAAGGCGCGATCGGCATCGAAATTGA
GGACCGCCAGGCCAAGGTTGCAGCCGCTCTTGCCGAAACCGAATCCGCTTTGCTAGCCGCAAAGGCTCGC
TGGGAAAAGGAGCAGGCCATGGTCTCTGAAATTCTCGATCTGCGGGCGAGGCTGCGCGGAAAGGGAGTCG
AACTCGACCATGCGTTGGCCGACGGGGCGGCAGGCGATCAAGCGGCAGCAACCCCAATTGTGGATGAGCC
CGCGTCGGGAGCCAGCGAAGGAGCGATCGCCGACCAGAATTCGGACCTTGTGCGGCTCAAGACGCTGATG
GCGGAACTTGCCGATGCACAGGGTGAAACCCCGCTCATATTGCTTTCCGTGGACAGGAATGCCGTGGCCT
CGGTGGTACAGGATTGGACAGGTATACCGGTTGGCAGGATGCTGACCAGCCAGACCGAAAAGGCGTTGCA
GCTGGCAAACGTTCTGTCAGAGCGTGTCGTCGGTCAGGACATCGCGATGGAGTCGATCGCTCGGCGCGTA
CAGACCAGCCGAGCCGGATTAGGCTCTCCCGAAAAGCCCGTCGGTGTCTTTCTGCTGTGCGGCCCGTCCG
GGGTCGGTAAGACGGAAACTGCACTGGCTCTCGCCGAGGCGCTCTATGGCGGCGAACAGAATCTGATCAG
CATCAACATGTCCGAGTTTCAGGAGGCCCATACAGTCTCCACTCTCAAGGGTGCGCCTCCGGGCTATGTT
GGCTATGGCAAGGGGGGCGTCCTGACCGAAGCCGTCAGACGACGACCCTATTGTGTTATTTTGCTCGATG
AAGTCGAGAAGGCACATCCGGATGTGCACGAGATCTTTTTCCAGGTATTTGACAAAGGGATGATGGACGA
CAGCGAGGGTCGACGGATCGACTTCCGCAACACTCTCATACTGCTGACCTCGAACGTTGGTTCAGACGCC
ATCATGAAGCTTACCGATGGAGGCCGGATGCGGCCCCCACCTGAGGAGTTGGAAGCCGTACTGCGGCCGC
AATTGCTGAAGGTATTTCCGCCGGCATTTCTCGGACGGGTTATTGTCATCCCCTATTATCCGCTCTCCGA
TGCGATGATCGAGGCAATAACACGACATCACTTCGGGAAAATCGCGCGCCGGTTACGCGCCAGCCATGAT
GCTGAGCTGGTCATCGAGGACGGAGTTCGGGAATTGGTCAAGGCGCGTTGTACCGAGGTCGAATCGGGAG
GTCGCATGATCGACGCGATCCTGACCAACACGCTTCTACCGGCGTTGAGCAAAGGCGTTCTGAATTGGTC
GCTCGAAGGCAAACGCCTGACCAAGGTCACGGTCGGCGCATCTGAGGAAGGCTTCACCTACTCGTTCGAA
TGA