SecReT6
Protein ID: 39995536
SecReT6 ID11
T6SS typeN/A
Gene symbol-
Locus tagGSU0428
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]457223..457777 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ74G24
KEGG IDgsu:GSU0428
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.00E-27, Aligned region: 15..172
Protein Sequence: 184 a.a.     [Download]
>gi|39995536|ref|NP_951487.1| unnamed protein product [Geobacter sulfurreducens PCA]
MKRHSALLPCWSVVACLCSCASSPEVRPPVEWGFEREAIHLSLTGDPRLNLYQNSPHALVACIYQLRDPN
AFNQLRNEPDGPARLLECSRFDQAVATARRVVIQPGQVLNDVLDRAEGARYVGFAAGYYLLDKERSVRLY
PIPISEETKGFVSRTKLVKPGRVDIRLHLGPQEIQDVKEEPRKP
 
Nucleotide Sequence: 555 bp     [Download]
>gi|39995111|ref|NC_002939.4|:457223-457777 Geobacter sulfurreducens PCA chromosome, complete genome
ATGAAGCGTCATTCCGCTTTGTTGCCGTGTTGGTCTGTCGTTGCGTGCCTCTGCTCCTGTGCCTCGTCTC
CGGAGGTCAGGCCGCCGGTTGAGTGGGGGTTCGAAAGGGAGGCCATTCATCTGAGCCTCACCGGCGACCC
CCGGCTGAATCTCTATCAGAACAGCCCCCACGCACTTGTTGCCTGCATCTACCAACTTCGCGATCCGAAC
GCCTTCAACCAGTTGCGGAACGAACCGGACGGGCCGGCAAGGCTGCTGGAATGCAGCAGGTTCGACCAAG
CCGTGGCAACGGCCAGGCGGGTTGTCATCCAGCCAGGTCAGGTATTGAACGACGTCCTGGATCGGGCCGA
GGGGGCACGCTACGTGGGTTTTGCGGCGGGATACTACCTGCTCGACAAGGAACGGTCGGTCCGGCTCTAC
CCGATCCCGATCAGTGAGGAGACGAAGGGATTCGTCAGCCGCACGAAGCTCGTCAAGCCGGGACGGGTCG
ATATTCGGCTGCATCTGGGCCCTCAGGAGATTCAGGATGTGAAGGAGGAGCCCCGAAAGCCATGA