SecReT6
Protein ID: 39995537
SecReT6 ID11
T6SS typeN/A
Gene symbol-
Locus tagGSU0429
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]457774..459165 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ74G23
KEGG IDgsu:GSU0429
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-102, Aligned region: 19..460
Protein Sequence: 463 a.a.     [Download]
>gi|39995537|ref|NP_951488.1| unnamed protein product [Geobacter sulfurreducens PCA]
MNAHPPLYWHQGLFLQPHHFQLQDLSVQGRLAPLFRHLHPHFWGAGELEIEASALGTRVFSILSGEFLFP
DGTWAVIGENALCEPRSFDDSWIEGDRPLPVYVGVRKWSGDRENVTVTERLENLGGITTRFAAAADPEEM
RDLHAGGPAGQVKRLRHVLKILWDSERDQLGDWHLIPVARLERFGADVRLSGRFIPPCLSLEASEPLFRI
VREIRDQVAARARQLEEHKKQRGIQNAGFGSRDMVYLLALRSLNRHVPLLFHLTEARQVHPWDVYGALRQ
LIGELSSFSERVSALGKLDDGVRLLPPYDHRALGERFFVARDLIARLLDEITAGPDYVIRLTHDGTFFSA
DLKPGIFETGSRYYLALRTTTEPAAFLPSLEAAAKLSARNHLPVLAARALPGIGLSHLPVPPQELPRRAD
THYFAVDTAGDQWPLVEREHALALHWTGAPADLEVELMVVAKG
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|39995111|ref|NC_002939.4|:457774-459165 Geobacter sulfurreducens PCA chromosome, complete genome
ATGAACGCCCATCCCCCCCTTTACTGGCACCAGGGGCTCTTTCTCCAGCCCCATCACTTTCAGCTCCAGG
ACCTGTCGGTCCAGGGGCGTCTCGCCCCCCTGTTCCGCCATCTCCACCCCCACTTCTGGGGGGCGGGTGA
GCTGGAGATCGAGGCCAGCGCTCTCGGCACCCGGGTCTTCAGCATCCTTTCCGGCGAGTTCCTTTTCCCC
GACGGCACCTGGGCGGTCATCGGCGAGAACGCCCTCTGCGAGCCGCGCTCCTTCGACGACTCCTGGATCG
AAGGGGATCGTCCCCTGCCGGTCTACGTGGGAGTGCGCAAGTGGAGCGGGGATAGAGAGAACGTGACCGT
CACCGAACGGCTCGAAAACCTCGGCGGGATCACCACCCGCTTCGCCGCCGCGGCAGATCCGGAGGAGATG
CGCGATCTCCACGCCGGCGGCCCGGCAGGTCAGGTGAAGCGGCTGCGCCATGTGCTGAAAATCCTCTGGG
ACAGCGAGCGGGACCAACTGGGCGACTGGCACCTGATCCCGGTGGCGCGGCTGGAGCGCTTCGGGGCCGA
CGTGCGGCTCTCCGGCCGCTTCATCCCCCCTTGCCTCTCCCTCGAAGCGAGCGAGCCCCTCTTTCGCATC
GTCCGGGAGATCCGGGACCAGGTGGCGGCCCGCGCCAGACAGCTGGAGGAGCACAAGAAGCAGCGCGGCA
TCCAGAACGCCGGGTTCGGCTCTCGGGACATGGTCTACCTCCTGGCGCTCCGTTCTCTCAACCGGCATGT
GCCTCTCCTCTTCCACCTGACCGAGGCGCGGCAGGTCCACCCGTGGGACGTCTACGGGGCCCTGCGCCAG
CTCATCGGCGAACTCTCCTCCTTCTCCGAGCGGGTCTCGGCCCTTGGCAAACTGGACGACGGCGTCCGGC
TTCTCCCTCCCTATGATCACCGGGCACTCGGGGAGCGCTTTTTCGTGGCCCGTGACCTCATCGCCCGACT
TCTGGACGAGATCACCGCCGGTCCCGATTACGTGATCCGCCTCACCCACGACGGCACCTTCTTCAGCGCC
GACCTGAAGCCGGGCATCTTTGAAACCGGCAGCCGCTATTACCTGGCCCTGCGGACCACCACGGAGCCGG
CTGCGTTCCTCCCGTCCCTTGAAGCCGCCGCCAAGCTCAGCGCCCGGAACCACCTGCCGGTCCTGGCCGC
CCGCGCCCTCCCCGGCATCGGCCTGAGCCACCTGCCGGTCCCGCCCCAGGAGCTGCCGCGCCGCGCCGAC
ACCCACTACTTCGCCGTTGATACTGCCGGTGACCAATGGCCCCTGGTGGAGCGGGAACACGCCCTTGCCC
TCCACTGGACCGGCGCCCCGGCCGATCTGGAGGTGGAGCTGATGGTGGTGGCCAAGGGGTAG