SecReT6
Protein ID: 39995538
SecReT6 ID11
T6SS typeN/A
Gene symbol-
Locus tagGSU0430
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]459169..459576 [+]
Producttail lysozyme
NoteTssE
UniProt IDQ74G22
KEGG IDgsu:GSU0430
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-20, Aligned region: 27..115
Protein Sequence: 135 a.a.     [Download]
>gi|39995538|ref|NP_951489.1| unnamed protein product [Geobacter sulfurreducens PCA]
MREERLLERIRSLERDPSRRGGTDRGRLVDSILAHVRRIINTRRGSVPIAPDFGIPDMLDVLQSYPDSVR
EIERSIRAAIQGFEPRLADVRVAFVPQEDDVLALRFAISARLGSDGGAVCFETLVDTDGKVTVRR
 
Nucleotide Sequence: 408 bp     [Download]
>gi|39995111|ref|NC_002939.4|:459169-459576 Geobacter sulfurreducens PCA chromosome, complete genome
ATGCGCGAAGAACGCCTTCTGGAACGTATCCGCTCCCTGGAGCGGGATCCGTCGCGCCGCGGGGGGACTG
ATCGGGGCCGTCTGGTGGATTCAATCCTGGCACACGTCCGCCGGATTATTAACACGCGCCGGGGGAGCGT
GCCTATCGCCCCTGACTTCGGCATCCCTGACATGCTCGACGTGCTTCAGAGCTACCCAGATTCGGTGCGG
GAGATCGAACGGAGCATCCGTGCCGCCATCCAGGGCTTTGAGCCGCGTCTCGCCGACGTAAGGGTTGCCT
TCGTCCCGCAGGAGGACGACGTGCTGGCGCTCCGGTTTGCCATCTCCGCCCGGCTTGGCAGCGACGGCGG
AGCGGTCTGTTTTGAAACGCTGGTGGATACCGACGGGAAGGTTACGGTGAGACGTTGA