SecReT6
Protein ID: 39995539
SecReT6 ID11
T6SS typeN/A
Gene symbol-
Locus tagGSU0431
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]459605..461338 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ74G21
KEGG IDgsu:GSU0431
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-180, Aligned region: 3..577
Protein Sequence: 577 a.a.     [Download]
>gi|39995539|ref|NP_951490.1| unnamed protein product [Geobacter sulfurreducens PCA]
MITRHFQDELARLKELGAEFSVTHPALAPMLGGPSTDPDVERLLEGVAFQTALLRQKLDDDFPEVVHDLV
RLVAPHYLRPVPATTIVAFEPKPSLTRSRLIPAGTELASIPVEGTRCLFRTTSPVELHPLELLEATFAQP
AGSAPVVTLSLSLTGLSLDHWEPRSLRFFLAGDHAPAAELFLILSRHLKRIVITPEERGASASLPAACLQ
PVGLNDDEHLIPWPSHAFPGYRLLQEYFAAPQRFLFLELTGWERWTTRGSGSRFTITFELGELTIPPPPV
RRDSFVLFASPAVNLFSHDAEPILLDHRVGRYPVRPAGLEPGHGQVYSVDRVTGIVRGAATERIYHPFEQ
FRDGADAQPTFHTAVSASPVRAGFDVHLAVAYPQGEGLPETETLSIALTCSNGRLPENLWLGDLCEPTSS
SPESATFHNITPLTPTLLPPLGKNLLWRLVSHLSLNRLSLASADNLRTLLALYLFEEGGDRGDLAANRKR
LDGIEAVIAKPAGRLVGGHLLRGSEIVLTLRGDHFASPGDLFLFGAVLDRFLGGYASLNSFTRLTVRESV
RGEVYSWAPRLGHRQLL
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|39995111|ref|NC_002939.4|:459605-461338 Geobacter sulfurreducens PCA chromosome, complete genome
ATGATCACCCGTCATTTTCAGGATGAACTCGCCCGACTCAAGGAGTTGGGGGCCGAGTTCTCCGTGACCC
ACCCGGCGTTGGCGCCGATGCTCGGCGGTCCGTCGACCGACCCGGATGTGGAGCGGCTCCTGGAGGGCGT
TGCCTTCCAGACGGCTCTCCTTCGCCAAAAACTCGATGATGATTTCCCCGAAGTGGTCCACGATCTGGTT
CGTCTTGTGGCCCCCCACTACCTGCGGCCGGTGCCGGCCACCACCATCGTCGCCTTCGAACCGAAGCCGT
CACTGACTCGCTCACGGCTGATTCCGGCCGGGACCGAGCTTGCGTCGATCCCGGTGGAGGGAACCCGCTG
CCTCTTCCGGACAACGAGCCCGGTAGAACTTCATCCTCTGGAACTTCTCGAGGCAACGTTTGCCCAACCA
GCAGGGAGCGCTCCAGTCGTAACCCTGTCCCTGTCGCTCACTGGCCTCTCGCTCGACCACTGGGAGCCAC
GATCGCTGCGATTTTTTCTGGCCGGCGACCATGCCCCGGCAGCGGAGCTGTTCCTGATCCTCTCCCGGCA
CCTGAAGCGAATCGTGATCACCCCGGAGGAGAGAGGGGCGTCGGCCAGCCTGCCCGCAGCCTGTCTTCAG
CCGGTGGGCCTCAATGACGACGAGCACCTGATTCCCTGGCCATCCCACGCCTTTCCCGGCTATCGGCTGT
TGCAGGAATATTTTGCCGCGCCCCAACGGTTCCTGTTCCTGGAGTTGACCGGCTGGGAACGCTGGACCAC
CCGTGGCAGCGGCTCGAGATTCACCATTACCTTCGAGTTAGGCGAACTCACTATCCCTCCGCCCCCGGTG
CGGCGGGATAGCTTTGTTCTTTTCGCCTCCCCGGCCGTGAACCTCTTTTCACACGACGCCGAACCGATTC
TCCTCGACCACCGGGTCGGGAGATACCCGGTGAGGCCTGCGGGTCTGGAACCGGGGCACGGTCAGGTATA
TTCCGTCGATCGTGTGACCGGTATCGTCCGGGGGGCGGCAACGGAGCGCATCTATCACCCCTTCGAGCAG
TTCAGGGATGGCGCAGATGCCCAGCCAACCTTTCATACCGCCGTATCCGCTTCGCCGGTCCGCGCCGGAT
TCGATGTGCACCTGGCCGTTGCCTACCCACAGGGGGAGGGGTTGCCGGAGACGGAGACGCTTTCCATCGC
TCTTACCTGCAGCAACGGCCGCCTGCCGGAAAATCTGTGGCTCGGCGACCTGTGCGAACCGACCTCCTCC
TCACCCGAGAGTGCCACCTTCCACAACATCACGCCACTTACCCCGACGCTGCTGCCGCCACTGGGGAAAA
ATCTCCTCTGGCGACTCGTTTCCCATCTGTCCCTTAACCGCCTCTCCCTGGCCAGCGCCGACAATCTCCG
CACTCTCCTGGCGCTCTACCTGTTCGAGGAGGGAGGGGACCGGGGTGACTTGGCCGCCAACCGGAAGCGG
CTGGACGGGATCGAAGCGGTTATCGCCAAGCCGGCCGGCCGCCTCGTGGGGGGGCACCTACTGCGGGGCA
GCGAGATTGTCCTTACTCTGCGGGGGGACCACTTTGCCAGCCCGGGCGATCTGTTCCTCTTCGGGGCGGT
GCTCGACCGCTTTCTGGGGGGCTATGCCTCGCTCAACAGCTTCACCCGCCTGACCGTCCGCGAAAGCGTT
CGGGGAGAGGTGTACTCATGGGCTCCCCGCCTTGGTCACCGCCAGCTTCTCTAG