SecReT6
Protein ID: 39995540
SecReT6 ID11
T6SS typeN/A
Gene symbol-
Locus tagGSU0432
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]461302..462294 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ74G20
KEGG IDgsu:GSU0432
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-77, Aligned region: 20..313
Protein Sequence: 330 a.a.     [Download]
>gi|39995540|ref|NP_951491.1| unnamed protein product [Geobacter sulfurreducens PCA]
MGSPPWSPPASLETQLFERGHEFSFAQAVRLLRLLAAAQGREGACPCGVRVRPELSLSFPVADVARIERQ
SDGYRITARFLGLYGPSSPLPTFYTEELIDEEREDGSASRDFLDVLSHRIFDLWVAGDAKYRLFNRVVED
GSGDDLERLFCLAGLDLAQGQTVLPESGRWLRYVGLLGQVPRSALGLRTMVADALGVPVEVIPCQHRQVS
IPPGQRLAVGIAASSLGIDTVVGTNLDDRLGMFRLCLGPLSREQFADLLPGAPGRSTLDLIVELYLDAPL
AWDVELTLAPGETPEARLGACRGARVGWDTWLGVAAGESLPCVVFPGHFP
 
Nucleotide Sequence: 993 bp     [Download]
>gi|39995111|ref|NC_002939.4|:461302-462294 Geobacter sulfurreducens PCA chromosome, complete genome
ATGGGCTCCCCGCCTTGGTCACCGCCAGCTTCTCTAGAGACGCAGCTGTTCGAGCGGGGGCATGAGTTCT
CCTTTGCCCAGGCGGTGCGCCTGCTGCGGCTTCTTGCGGCCGCTCAGGGGAGGGAGGGCGCTTGCCCGTG
CGGGGTACGGGTCCGGCCCGAGCTTTCCCTCTCCTTTCCGGTTGCTGATGTGGCGCGGATCGAGCGGCAG
AGCGACGGCTACCGGATAACGGCCCGCTTCCTCGGTCTCTACGGCCCGTCATCTCCCCTGCCAACCTTCT
ACACCGAAGAACTGATAGACGAGGAGCGGGAAGACGGCTCTGCTTCACGGGATTTTCTCGACGTGCTGAG
CCACCGGATCTTTGATCTCTGGGTCGCCGGCGACGCCAAGTATCGCCTGTTCAACCGGGTTGTGGAGGAC
GGAAGCGGGGATGACCTCGAACGTCTTTTTTGTTTGGCTGGGCTCGACCTGGCCCAGGGGCAGACAGTCC
TGCCGGAGTCCGGCCGCTGGCTCCGCTATGTGGGTCTCCTGGGACAGGTTCCCCGCTCTGCCCTGGGGTT
GCGGACCATGGTCGCCGACGCCCTCGGCGTACCGGTTGAAGTCATCCCCTGCCAGCACCGGCAGGTGTCG
ATTCCCCCCGGACAGCGGCTAGCCGTGGGCATAGCCGCGAGCAGTCTCGGCATCGACACGGTCGTCGGAA
CCAATCTGGATGACCGGCTGGGCATGTTCCGCCTGTGCCTGGGGCCCCTTTCCCGCGAACAGTTCGCGGA
TCTCCTCCCCGGCGCCCCTGGCCGCTCGACTCTGGACCTGATCGTGGAACTCTACCTGGATGCCCCCCTC
GCCTGGGACGTGGAGTTGACCCTGGCCCCGGGAGAGACGCCGGAAGCACGTCTCGGCGCTTGTCGGGGGG
CACGGGTCGGATGGGACACCTGGCTTGGTGTCGCAGCCGGCGAATCCCTGCCTTGCGTTGTATTTCCCGG
ACATTTTCCCTAA