SecReT6
Protein ID: 39995541
SecReT6 ID11
T6SS typeN/A
Gene symbol-
Locus tagGSU0433
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]462307..464934 [+]
ProductclpB protein
NoteTssH
UniProt IDQ74G19
KEGG IDgsu:GSU0433
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.10E-38, Aligned region: 219..238
AAA_2 [PF07724], Evalue: 6.10E-38, Aligned region: 602..767
AAA [PF00004], Evalue: 3.60E-16, Aligned region: 221..333
AAA [PF00004], Evalue: 3.60E-16, Aligned region: 607..705
ClpB_D2-small [PF10431], Evalue: 1.00E-12, Aligned region: 773..843
AAA_5 [PF07728], Evalue: 4.80E-12, Aligned region: 221..241
AAA_5 [PF07728], Evalue: 4.80E-12, Aligned region: 606..721
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 198..238
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 266..299
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 441..490
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 577..630
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 673..699
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 749..806
AAA_22 [PF13401], Evalue: 9.50E-08, Aligned region: 220..306
AAA_22 [PF13401], Evalue: 9.50E-08, Aligned region: 402..430
AAA_22 [PF13401], Evalue: 9.50E-08, Aligned region: 604..625
AAA_22 [PF13401], Evalue: 9.50E-08, Aligned region: 668..700
AAA_22 [PF13401], Evalue: 9.50E-08, Aligned region: 735..761
AAA_19 [PF13245], Evalue: 6.20E-06, Aligned region: 218..242
AAA_19 [PF13245], Evalue: 6.20E-06, Aligned region: 415..428
AAA_19 [PF13245], Evalue: 6.20E-06, Aligned region: 604..628
Arch_ATPase [PF01637], Evalue: 4.10E-05, Aligned region: 199..235
Arch_ATPase [PF01637], Evalue: 4.10E-05, Aligned region: 273..308
Arch_ATPase [PF01637], Evalue: 4.10E-05, Aligned region: 604..619
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 25..65
NACHT [PF05729], Evalue: 0.0002, Aligned region: 221..248
NACHT [PF05729], Evalue: 0.0002, Aligned region: 417..439
NACHT [PF05729], Evalue: 0.0002, Aligned region: 606..645
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 221..241
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 452..452
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 605..641
IstB_IS21 [PF01695], Evalue: 0.00051, Aligned region: 215..244
IstB_IS21 [PF01695], Evalue: 0.00051, Aligned region: 606..624
Sigma54_activat [PF00158], Evalue: 0.00067, Aligned region: 217..235
Sigma54_activat [PF00158], Evalue: 0.00067, Aligned region: 606..719
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 221..245
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 277..308
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 429..484
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 604..638
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 215..237
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 604..631
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 221..241
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 607..642
MobB [PF03205], Evalue: 0.0091, Aligned region: 221..243
MobB [PF03205], Evalue: 0.0091, Aligned region: 605..628
Protein Sequence: 875 a.a.     [Download]
>gi|39995541|ref|NP_951492.1| unnamed protein product [Geobacter sulfurreducens PCA]
MLTVDLTALLKRLNPLCTRVLEGAAGLCVARGHYEVTVEHFLARLLDEAGGDLVAVLRNSNIDASPLKIG
VVRVLDELPTGNGGRPVFSPILLEWLQAGWLTASLDLNEERVRSGALFAALLARPLRFAAGRYVDQLMPV
GREGLLSGFSRAVSGSEENSCMGGDTASVAGPGRDGTALSRFCTDFTARAAEGGMDPVFGRDREIGRMID
ILARRRKNNPIVVGEAGVGKTAVVEGLALRIVEGEVPEALREVRLLGLDLGLLQAGAGVKGEFESRLKSV
IEEVKGASRPVILFIDEAHTLIGAGNQAGGGDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALARR
FQPVKLDEPSVETAVLILRGLKDTYEAAHGVTIRDDAVRAAAELSSRYLSGRQLPDKAVDLLDTAAARVK
LLLTGKPGRVEEAERRIQALEREEAALRRDRLQGRPEDEGRLAVLKEELALLREELAAVTARWHRERELA
GAVVALRNEAAEGRDAGGDAVGLKMAEPAAKLAEVQGDEPLVRIEVDPEVVAQVVADWTGIPLGRLRKDR
TAGVLALEEGLRRRIRGQEPALAAVAEVLRSSAAGLKDPRQPLGVFLLVGPSGVGKTETAVAVADLLFGG
ERFLTVINMSEFQERHTTSRLIGSPPGYVGYGEGGVLTEAVRRSPYSAVLLDEVEKAHPDVLNLFYQVFD
KGMLADGEGRVIDFANTVIFLTSNLAADVVVSRCAEEPQPTTEELAAAIRPHLARHFKPALLARMTVVPY
LTLAPDSLEEIVGLKLGRVAERLRENSRTELAWTPAVAARLAARCSEVESGARAIDHILRGTLLPLLSRE
ILARIGGGEELEAIRLDVAADGSFTVGCGDGAAVR
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|39995111|ref|NC_002939.4|:462307-464934 Geobacter sulfurreducens PCA chromosome, complete genome
GTGCTGACCGTCGACCTTACCGCTCTTCTCAAGCGACTCAACCCCCTCTGCACCCGGGTACTGGAGGGGG
CCGCAGGACTCTGCGTGGCCAGAGGGCACTACGAAGTGACTGTTGAACACTTCCTGGCCAGGTTGCTCGA
TGAGGCGGGGGGGGACCTTGTTGCCGTTCTGCGGAACTCTAACATCGACGCCTCCCCGCTGAAGATCGGA
GTCGTCCGGGTTCTCGACGAGTTGCCCACCGGCAACGGGGGGCGGCCGGTCTTCTCCCCGATCCTCCTGG
AGTGGCTCCAGGCGGGGTGGCTCACGGCCTCCCTCGATCTGAACGAGGAGCGGGTCCGCTCCGGAGCGCT
CTTCGCGGCGCTCTTGGCCCGGCCGCTGCGGTTCGCGGCGGGCCGCTACGTGGACCAGCTCATGCCCGTG
GGACGGGAGGGGCTTCTCTCCGGCTTTTCGCGCGCTGTTTCCGGCTCGGAGGAGAACTCCTGCATGGGCG
GCGACACCGCTTCCGTCGCCGGGCCCGGCCGGGATGGCACGGCACTTTCCCGCTTCTGCACCGACTTCAC
CGCACGAGCGGCCGAGGGGGGCATGGACCCGGTCTTCGGCCGTGATCGGGAGATCGGCCGGATGATCGAC
ATCCTGGCCCGGCGGCGGAAGAACAACCCCATCGTGGTGGGAGAGGCGGGGGTCGGCAAGACCGCCGTGG
TGGAGGGGCTGGCACTCCGTATCGTTGAGGGGGAGGTGCCGGAGGCATTGCGGGAGGTGAGGCTCCTGGG
GCTTGATCTCGGCCTGCTCCAGGCGGGGGCAGGGGTGAAAGGGGAGTTCGAGAGCCGTCTGAAGAGCGTT
ATCGAAGAGGTAAAGGGGGCTTCCCGGCCGGTGATTCTCTTTATCGATGAGGCCCACACCCTGATCGGTG
CCGGCAACCAGGCGGGCGGGGGTGATGCCGCCAACCTTCTGAAGCCGGCCCTGGCCCGGGGTGAGCTGCG
CACCATAGCCGCCACCACCTGGAGCGAATACAAGAAATATTTCGAGAAGGATGCCGCCTTGGCCAGGCGC
TTCCAGCCGGTGAAGCTGGACGAACCGTCGGTGGAGACGGCGGTGCTGATCCTGCGGGGCCTCAAGGATA
CGTACGAGGCGGCCCATGGGGTCACCATCCGGGATGACGCAGTCCGGGCGGCGGCGGAGCTCTCGTCCCG
CTACCTGTCGGGCCGGCAGCTGCCGGACAAGGCGGTGGATCTCCTTGATACGGCTGCGGCCCGGGTGAAG
CTCCTGCTCACCGGCAAGCCGGGAAGGGTAGAGGAGGCGGAGCGGCGCATCCAGGCCCTGGAGCGGGAAG
AGGCCGCCCTCCGCCGTGATCGGCTCCAGGGGCGGCCGGAGGACGAAGGACGGCTGGCGGTGCTGAAGGA
GGAGCTGGCGCTGTTGCGGGAGGAGCTGGCTGCCGTAACGGCTCGCTGGCACCGGGAACGAGAGCTGGCC
GGGGCGGTGGTGGCCCTGCGGAACGAGGCAGCGGAGGGCCGTGACGCAGGTGGGGACGCAGTGGGGCTGA
AGATGGCGGAACCCGCGGCAAAGCTGGCGGAAGTCCAGGGGGATGAGCCGCTGGTCAGGATCGAGGTGGA
CCCGGAGGTGGTTGCGCAGGTGGTGGCCGACTGGACCGGCATTCCCCTAGGGCGCCTCCGCAAGGACCGG
ACCGCCGGGGTGCTTGCCCTGGAAGAGGGCCTGCGCCGGCGCATCCGGGGGCAGGAACCGGCGCTGGCCG
CCGTGGCCGAGGTGCTCCGTTCCTCGGCTGCTGGCCTCAAGGACCCGCGCCAGCCTCTGGGGGTCTTCCT
GCTTGTCGGCCCCTCCGGCGTCGGCAAGACCGAAACCGCCGTGGCCGTGGCCGATCTTCTTTTCGGCGGC
GAACGGTTCCTCACCGTCATCAACATGAGCGAATTTCAGGAGCGCCACACCACCAGCCGTCTCATCGGCT
CGCCGCCGGGGTACGTGGGGTATGGTGAGGGCGGCGTCCTTACCGAGGCGGTCCGCCGCAGCCCCTACTC
GGCGGTGCTGCTGGACGAGGTGGAAAAAGCCCACCCCGACGTCCTCAATCTCTTTTACCAGGTGTTCGAC
AAGGGGATGCTGGCCGACGGGGAGGGGCGGGTGATCGACTTCGCCAACACGGTCATCTTTCTGACGAGCA
ATCTGGCGGCGGATGTCGTCGTCTCGCGCTGCGCGGAAGAGCCGCAGCCCACGACAGAGGAGCTGGCCGC
CGCCATCCGCCCCCATCTCGCGCGGCACTTCAAACCGGCGCTCCTGGCCCGCATGACCGTGGTCCCCTAC
CTGACCCTGGCGCCGGACAGCCTGGAGGAGATCGTGGGCCTCAAGCTCGGCCGGGTGGCGGAGCGGCTCC
GGGAGAACAGCCGAACGGAGCTTGCGTGGACCCCGGCGGTTGCGGCCCGGCTCGCTGCCCGTTGCTCCGA
AGTGGAGAGCGGCGCCAGGGCCATCGACCATATCCTGCGCGGAACCCTCCTGCCGCTCCTCTCCCGGGAG
ATCCTGGCGCGGATCGGCGGAGGAGAGGAGCTGGAGGCAATCCGGCTCGATGTAGCAGCCGACGGTTCCT
TTACCGTCGGCTGTGGGGACGGTGCGGCGGTCCGGTGA