SecReT6
Protein ID: 39998255
SecReT6 ID12
T6SS typei1
Gene symbol-
Locus tagGSU3165
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]3469894..3470688 [+]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.10E-43, Aligned region: 38..251
Protein Sequence: 264 a.a.     [Download]
>gi|39998255|ref|NP_954206.1| unnamed protein product [Geobacter sulfurreducens PCA]
MLNGTAVRPCPVMPIDAGFDPAFGRRTAAAGREVYPSMHLTDCFTDVMAYLNHSLRTIGVRQPPYGEIRC
EIERFMATADAAARSEGLDGEEFDLARFAVCAWIDEAILSSSWEEKNTWLKEQLQRIHYATTDAGEEFFT
RLTALGLNQREVREVFYLCLAFGFTGKYCKPGDEYHLEQLKTAQLKLLMGSSVGLPSLERTELFPEAWPS
GPAPATVRPGRGQGSRAFLVAVAAVPVALFLILLLAYRFTLTGVGDTFLRTVPY
 
Nucleotide Sequence: 795 bp     [Download]
>gi|39995111|ref|NC_002939.4|:3469894-3470688 Geobacter sulfurreducens PCA chromosome, complete genome
GTGCTTAACGGTACCGCCGTGCGTCCATGCCCCGTCATGCCCATCGATGCCGGGTTCGATCCTGCCTTCG
GCCGTCGCACAGCAGCGGCCGGCAGAGAGGTTTATCCATCCATGCATCTGACCGACTGCTTCACAGACGT
TATGGCCTACCTGAACCACTCCCTCCGGACCATCGGGGTCCGACAGCCCCCCTACGGAGAAATTCGCTGT
GAAATCGAACGGTTCATGGCGACGGCGGATGCCGCAGCCCGCAGCGAAGGGCTCGACGGGGAGGAATTCG
ACCTGGCGCGCTTCGCCGTCTGCGCCTGGATCGACGAAGCGATTCTCTCCTCATCATGGGAAGAAAAAAA
CACCTGGCTGAAGGAACAACTCCAGCGCATCCACTACGCCACCACCGACGCGGGGGAGGAATTCTTCACC
AGGCTCACGGCGCTCGGGCTCAATCAGCGGGAGGTGCGGGAAGTGTTCTATCTCTGCCTGGCCTTCGGCT
TTACCGGCAAATACTGCAAGCCTGGCGACGAGTACCACCTGGAACAGTTGAAAACCGCCCAGCTGAAACT
GCTGATGGGAAGTTCGGTAGGACTTCCCTCTCTGGAACGGACCGAACTCTTTCCCGAGGCATGGCCGTCG
GGGCCGGCACCGGCAACCGTCCGCCCCGGACGCGGGCAGGGAAGCCGGGCGTTCCTGGTTGCCGTGGCAG
CTGTGCCGGTGGCCTTGTTCCTGATTCTGCTCCTGGCCTACCGCTTCACGCTCACGGGCGTGGGTGACAC
GTTCCTGAGGACGGTACCATACTGA