SecReT6
Protein ID: 39998257
SecReT6 ID12
T6SS typei1
Gene symbol-
Locus tagGSU3167
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]3474201..3476570 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ747U8
KEGG IDgsu:GSU3167
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.20E-19, Aligned region: 313..373
DUF2094 [PF09867], Evalue: 1.40E-10, Aligned region: 12..101
DUF2094 [PF09867], Evalue: 1.40E-10, Aligned region: 696..729
Protein Sequence: 789 a.a.     [Download]
>gi|39998257|ref|NP_954208.1| unnamed protein product [Geobacter sulfurreducens PCA]
MPSVDPCWRWSAFGKHPAAADYFRLGEDSPFVEGLAAWVENGYRHLISRHEATMPFCSWRFWARGFGRDS
LVLGVVRLSSDSLGRSYPLLIMGSGPLEGWEEQWDLLPFACEPSWCQIEYLATHSFDGLKHVGEELRRVR
PPGSDWDELAERRRGLNRLGSPLDPYASFLDIPSLERLVAEHSGREEFSVRLDRGPVHDKITLVSLWHLL
TKRTVKGVPHTLFMGGNLEHSFLASFRRALAPGDFLHLWSAPEAGGWHDSIGTGHALDIASIGKEPVCPE
RPAGEDIRYDPLFDALQAEVDKLTSPAVAGAVDWERVVHMAADILATRSKDLLVASYLAVGLVQTRGGDG
LALGLTVWRDLLERFWCTLYPTRTRGRQRSVEWWLDRTVIALHHQGNWSLPPEQHGIVLETLGAIDRFLG
ERLEDAPSLTKLRQLLADMAPEGGEETAPEAVVATPAQAEAPATGLFAPPRQTAAPAVEPPCQAIATGSS
LQMLEEALRQVGEAAGALIQQDPAAPVSYRLSRLAAWGKVTELPPSINGRTRIPPPERQVLTLLQELASH
GDGEALLKAAEARLPQFIFWLDLSRLTAKALCRLGDRFAAAREAVCAETAAFVGRLPALPDLTFADGTPF
AAPETRQWLTGLAQRGASVADCPAVGHNDGRAAAIAREVEEAQALIRDGKLLEAVERFQKQLGNGASRKE
RLHWRLALAQLLVNTNRAKLALPHLEQVVADIEAFGLEEYDPALALRGLKLAWAGFDSQIEPRFKEKAAD
ALHRIARLDPVEMVRLTKG
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|39995111|ref|NC_002939.4|:3474201-3476570 Geobacter sulfurreducens PCA chromosome, complete genome
ATGCCCTCCGTTGATCCGTGCTGGCGCTGGTCTGCCTTCGGCAAACATCCTGCCGCAGCTGACTATTTTC
GGCTCGGTGAGGATTCTCCCTTTGTCGAAGGATTGGCCGCATGGGTGGAGAACGGGTACCGGCATCTCAT
CAGTCGGCACGAAGCGACAATGCCGTTCTGCTCCTGGCGCTTCTGGGCCCGCGGGTTCGGCCGGGATTCC
CTTGTCCTTGGAGTGGTCCGGCTCTCCAGCGACAGCCTCGGCCGCTCCTATCCGCTGCTCATCATGGGAA
GCGGCCCCCTTGAGGGATGGGAAGAGCAGTGGGACCTGCTCCCTTTTGCTTGTGAACCGTCATGGTGCCA
GATCGAGTACTTGGCGACGCATTCCTTTGATGGTCTGAAGCACGTGGGTGAAGAACTCCGAAGGGTTCGC
CCCCCCGGGTCGGACTGGGACGAGCTGGCGGAACGGCGCCGCGGCCTGAACCGGCTCGGTTCCCCCCTTG
ATCCCTATGCATCCTTCCTGGACATCCCCAGTCTCGAACGACTGGTCGCCGAACATTCCGGCCGGGAAGA
GTTTTCCGTCAGACTCGACCGGGGGCCGGTGCATGACAAAATCACCCTGGTAAGCCTTTGGCACCTCCTG
ACCAAGAGGACCGTCAAAGGAGTCCCCCACACCCTTTTCATGGGCGGCAACCTGGAACACTCCTTTCTCG
CCTCCTTCCGGCGGGCCCTGGCCCCGGGGGATTTTCTCCACCTCTGGTCCGCGCCGGAGGCAGGAGGATG
GCACGACAGCATCGGAACGGGGCACGCCTTGGACATTGCATCTATCGGAAAAGAACCGGTGTGCCCCGAA
CGGCCGGCCGGCGAGGATATTCGCTACGATCCCCTCTTCGACGCGCTCCAGGCGGAGGTTGACAAGCTCA
CCTCCCCCGCCGTGGCCGGTGCCGTCGACTGGGAACGGGTGGTACATATGGCAGCCGACATCCTCGCCAC
CCGGTCCAAAGACCTCCTTGTGGCGAGCTACCTGGCAGTGGGACTCGTCCAGACCCGCGGGGGTGACGGC
CTCGCTCTGGGGCTCACTGTCTGGCGCGATCTCCTGGAACGGTTCTGGTGCACCCTCTACCCCACCCGCA
CACGGGGGCGCCAACGATCGGTGGAGTGGTGGCTGGATCGGACCGTGATCGCCCTGCATCATCAGGGAAA
CTGGTCCCTTCCCCCTGAGCAACACGGCATTGTGCTGGAAACCCTTGGCGCCATAGACCGCTTTCTGGGA
GAGCGCCTGGAGGATGCCCCCTCCCTTACGAAACTGAGGCAACTACTGGCGGACATGGCGCCGGAAGGCG
GAGAAGAAACGGCCCCCGAAGCCGTGGTTGCTACGCCGGCTCAAGCCGAGGCTCCCGCCACTGGCCTATT
CGCTCCGCCCCGTCAAACCGCCGCCCCCGCCGTGGAGCCCCCCTGTCAGGCGATTGCCACTGGCTCCTCC
CTTCAGATGCTGGAGGAAGCGCTTCGCCAGGTGGGGGAGGCGGCCGGCGCCCTCATCCAGCAGGATCCCG
CGGCCCCCGTATCCTATCGGCTCTCCCGCCTTGCCGCCTGGGGGAAGGTAACCGAGCTCCCGCCGTCGAT
AAACGGACGTACCCGAATCCCTCCTCCCGAGCGGCAGGTGCTGACCCTTCTCCAGGAACTGGCCAGCCAC
GGAGACGGCGAGGCGCTCCTGAAGGCGGCTGAGGCGCGGCTTCCCCAGTTCATCTTCTGGCTCGATCTGA
GCCGGCTCACCGCCAAGGCTCTCTGCCGCCTCGGCGACCGCTTTGCCGCCGCCCGCGAAGCGGTCTGCGC
GGAGACGGCCGCCTTTGTGGGTCGGCTTCCGGCCCTTCCTGACCTGACCTTTGCCGACGGCACTCCCTTT
GCCGCCCCGGAAACCCGCCAGTGGCTCACGGGGCTCGCACAGCGCGGGGCATCCGTTGCAGACTGCCCTG
CGGTGGGTCATAACGACGGCCGCGCCGCGGCCATTGCCCGGGAGGTGGAAGAGGCCCAGGCTCTCATTCG
GGACGGCAAACTCCTGGAGGCGGTGGAGCGGTTCCAGAAACAACTCGGCAACGGCGCCTCCCGCAAGGAG
AGGCTCCACTGGCGTCTCGCCCTGGCCCAACTCCTTGTGAACACCAATCGGGCCAAGCTGGCGCTCCCCC
ATCTAGAGCAGGTCGTGGCGGACATCGAGGCCTTCGGCCTCGAAGAGTACGACCCGGCCCTGGCCCTGCG
GGGGCTGAAGCTCGCCTGGGCCGGCTTCGATTCCCAGATCGAGCCCCGCTTCAAGGAAAAGGCCGCCGAT
GCCCTCCACCGGATCGCCCGCCTCGATCCGGTGGAGATGGTGCGACTGACGAAGGGGTAG