SecReT6
Protein ID: 39998262
SecReT6 ID12
T6SS typei1
Gene symbol-
Locus tagGSU3172
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]3481200..3481685 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ747U3
KEGG IDgsu:GSU3172
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-53, Aligned region: 5..158
Protein Sequence: 161 a.a.     [Download]
>gi|39998262|ref|NP_954213.1| unnamed protein product [Geobacter sulfurreducens PCA]
MSNEASVAPKERVNIVYRPADGEGREEVELPLKILVLGDFTGQPDERPVEKRDPVPVDKENFSEVMKAQR
IMLNIAVSNRLYDAPDEELPVKLKMESLRDFGPEAIVEQVPEMKRLLELREALRALKAPLSNIPDFRRKI
QELVTDDAARAKLLAEIGIEG
 
Nucleotide Sequence: 486 bp     [Download]
>gi|39995111|ref|NC_002939.4|:3481200-3481685 Geobacter sulfurreducens PCA chromosome, complete genome
ATGTCGAATGAAGCATCCGTAGCACCGAAGGAACGGGTGAACATCGTCTACCGTCCCGCCGATGGCGAAG
GGCGCGAGGAAGTGGAGCTTCCCCTTAAAATCCTGGTGTTAGGGGACTTTACCGGGCAACCGGACGAGCG
GCCCGTGGAGAAGCGGGACCCGGTGCCAGTGGACAAAGAAAACTTCAGCGAGGTCATGAAGGCCCAGAGA
ATCATGCTGAACATCGCCGTCTCCAACCGGCTTTACGATGCACCCGACGAGGAGCTGCCGGTGAAGCTGA
AAATGGAATCCCTGAGAGATTTCGGCCCGGAGGCCATTGTGGAGCAGGTCCCGGAGATGAAACGCCTGTT
GGAGTTGCGCGAGGCACTGCGGGCGCTGAAGGCTCCCCTCTCCAACATTCCGGACTTCCGGAGAAAAATT
CAGGAACTGGTCACTGACGATGCCGCCCGCGCCAAGCTGCTGGCTGAAATAGGGATCGAAGGGTAA