SecReT6
Protein ID: 39998263
SecReT6 ID12
T6SS typei1
Gene symbol-
Locus tagGSU3173
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]3481696..3483180 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ747U2
KEGG IDgsu:GSU3173
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-189, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|39998263|ref|NP_954214.1| unnamed protein product [Geobacter sulfurreducens PCA]
MSSEMNGTAPFQDQGATDVSLLEDIVRVTKLQPADEAYSITRRGVAALMAQLLEPGAEARKVSKAVLDDM
IAEIDRKLSLQMDEILHHPQFQALESSWRSLHFLVDRTDFRENNRIEFLNATKEELLDDFEDAPEVAKSG
LYKTVYSAEYGQFGGKPFGAIIGNYDFGPGAQDIKLLQSLAAVAGMAHAPFMAAASPQFFGCDDFTALPN
LKDISSILEGPQYAKWQAFRESEDARYVGLALPRFLLRLPYGEATRPAKCFNYEEQVSDSHDRYCWGNAA
FAFATRLTESFANFRWCANIIGPQGGGTVHDLPLHQYQAMGAIQTKIPTEVLISERREFELAEGGFIALT
MRKGSDNAAFFSANSVQKPKFFGSSKEGKEAELNYKLGLQLPYMFIVSRLAHYLKVIQREHIGTWKERGD
LENELNLWIRQYVSEMDNPMPGVRSRRPLRQAEVTVEEVPGEPGWYRVGLKVTPHFKYMGAYFTLSLVGK
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|39995111|ref|NC_002939.4|:3481696-3483180 Geobacter sulfurreducens PCA chromosome, complete genome
ATGAGCTCAGAGATGAACGGCACTGCCCCCTTTCAGGACCAGGGTGCGACTGACGTGTCGCTTTTGGAGG
ATATCGTCCGGGTCACTAAACTTCAACCGGCCGACGAAGCTTACTCTATCACCAGAAGAGGGGTCGCGGC
CCTCATGGCCCAGCTTCTGGAGCCGGGAGCCGAAGCCCGGAAGGTATCCAAAGCAGTGCTTGATGACATG
ATCGCCGAAATCGACCGCAAGCTCTCCCTCCAGATGGACGAAATCCTCCACCACCCCCAGTTCCAGGCAC
TTGAATCATCCTGGCGTTCGCTCCACTTCCTGGTAGATCGAACCGACTTCAGGGAAAACAACCGGATCGA
ATTCCTGAACGCCACCAAGGAGGAACTGCTGGACGACTTCGAGGACGCGCCCGAGGTGGCCAAATCGGGC
CTCTACAAGACCGTTTACTCCGCCGAGTACGGTCAGTTCGGCGGTAAGCCGTTCGGAGCGATCATCGGCA
ACTACGACTTCGGTCCGGGGGCCCAGGACATAAAGCTCCTCCAGAGCCTGGCTGCCGTAGCCGGGATGGC
CCACGCCCCCTTCATGGCCGCCGCATCTCCCCAGTTCTTCGGCTGTGATGACTTCACCGCCCTGCCGAAT
CTCAAAGACATCTCATCGATCCTCGAAGGCCCCCAGTACGCCAAGTGGCAAGCGTTCCGCGAGAGCGAAG
ATGCCCGCTACGTGGGACTGGCCCTGCCCCGGTTCCTCCTGCGACTCCCCTACGGCGAGGCCACCAGGCC
GGCCAAGTGTTTCAACTACGAAGAACAGGTCTCCGACAGCCACGACCGCTACTGCTGGGGCAACGCAGCC
TTCGCCTTCGCCACCCGGCTCACCGAGAGCTTTGCCAACTTCCGCTGGTGCGCCAACATCATCGGTCCCC
AGGGTGGCGGAACGGTGCATGACCTGCCGCTCCACCAGTACCAGGCAATGGGAGCCATCCAGACCAAGAT
CCCCACCGAAGTGCTCATCAGCGAGCGCCGCGAATTCGAGCTGGCCGAAGGAGGGTTCATTGCCCTTACC
ATGCGAAAAGGCAGTGACAATGCCGCCTTCTTCTCCGCGAACTCGGTCCAGAAACCGAAATTCTTCGGCA
GCTCCAAGGAGGGAAAAGAGGCCGAGCTCAACTACAAGCTGGGGCTCCAGCTCCCCTATATGTTCATCGT
CAGTCGCCTCGCCCACTATCTGAAGGTGATCCAGCGGGAGCACATCGGCACGTGGAAGGAACGGGGCGAT
CTGGAGAATGAGCTCAATCTGTGGATTCGTCAGTACGTCTCCGAGATGGACAACCCCATGCCCGGCGTTC
GCAGCCGCCGTCCCCTGCGCCAGGCCGAAGTGACCGTTGAGGAAGTCCCGGGCGAACCGGGCTGGTACCG
GGTGGGCCTCAAGGTCACCCCTCACTTCAAGTACATGGGGGCATACTTCACGCTGTCACTGGTGGGGAAA
CTGGATAAAGAGTAG