SecReT6
Protein ID: 39998264
SecReT6 ID12
T6SS typei1
Gene symbolhcP-2
Locus tagGSU3174
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]3483262..3483747 [+]
Producthcp protein
NoteTssD
UniProt IDQ747U1
KEGG IDgsu:GSU3174
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.30E-40, Aligned region: 7..146
Protein Sequence: 161 a.a.     [Download]
>gi|39998264|ref|NP_954215.1| hcP-2 gene product [Geobacter sulfurreducens PCA]
MAMPAHMTLTGEKQGKIDGSCELQGRENTIQLYEMKHDIHMPRNPHDGLPTGKRVHGPLSIVKMFDKSSP
KLYQALCTGEHMKNVQIKWYRINKQGLEEHYFTTTLEDAIVVEMKPYMPMTLLPANEPYGHMEEVAFSYK
KIKWTWEPNGIEAEDSWSVPK
 
Nucleotide Sequence: 486 bp     [Download]
>gi|39995111|ref|NC_002939.4|:3483262-3483747 Geobacter sulfurreducens PCA chromosome, complete genome
ATGGCAATGCCCGCCCACATGACCCTGACTGGAGAAAAACAGGGAAAGATCGACGGTTCCTGCGAACTGC
AGGGGCGCGAAAACACTATCCAGCTTTACGAAATGAAGCACGACATCCACATGCCGCGCAATCCCCATGA
CGGCCTGCCCACCGGCAAGCGCGTCCATGGCCCCCTGTCGATCGTCAAGATGTTCGACAAGAGTTCGCCG
AAACTCTATCAGGCCCTCTGCACCGGAGAGCACATGAAAAACGTGCAGATCAAGTGGTACCGTATCAACA
AACAAGGGCTGGAAGAGCACTATTTCACCACCACCCTTGAGGATGCCATCGTGGTCGAGATGAAACCCTA
CATGCCCATGACGCTCCTTCCTGCGAACGAGCCCTACGGCCATATGGAAGAGGTGGCATTCTCCTACAAG
AAGATCAAGTGGACCTGGGAGCCCAACGGTATCGAGGCTGAGGATTCCTGGAGCGTGCCCAAGTAG