SecReT6
Protein ID: 39998267
SecReT6 ID12
T6SS typei1
Gene symbol-
Locus tagGSU3177
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]3485350..3487443 [+]
ProductRhs family protein
NoteTssI
UniProt IDQ747T8
KEGG IDgsu:GSU3177
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-75, Aligned region: 39..332
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 373..467
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 517..526
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 528..550
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 552..566
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 559..582
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 567..589
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 604..622
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 631..654
Protein Sequence: 697 a.a.     [Download]
>gi|39998267|ref|NP_954218.1| unnamed protein product [Geobacter sulfurreducens PCA]
MTIQKAAASLLSQGSTSSFQFEIPATRHLLSVAGFTVDERISHPYDIHLTLATKDNVDLDEVIDKEAVLS
VDHEGGTRYFHGVVREFTSLGTDGDYDLYHAHIVPALWFLSLEQDCRVFQFKNVQDIVAEILEESNITSD
RYRFALSREDRLRKFCVQYRETDLNFVSRLLEEEGIFYFFEHYEDKHVIVFSDTGSGYLYMPGKRQIPFN
TNDGMVPGKESVFDFIYSRRVRPGKVSQRDYCYKHTNLDLTTQRQGKVSAQREVYDFPGNYFNEERGTYL
ANVRLERLLVLGATAEGQSSCPRMMPGHEWELSGHDYAGKYLPVAVIHHGAQPQVLGEHAGDGGFRYDNE
FIAVPAAVTVRPQIVAGRPAIVGLQTAVVTGSPGEEIHADPDGYLRVKVQFPWDRRGRKDGRTSCWVRVG
QPWGGGGWGTQFLPRVGDEVLVTFLEGDPDRPMVIGSAYNSENQPLYALPASKTQSGIRTRSYPNGGTDN
FHELRFEDKKGSEEIYLQSEKDWNILVKNDKGQTVGRNESLTVGNNRSKTVGVDQSESVGVNKSIQVGAN
HNESIGANMTLSVGGFKNETVGINSLETIGGAKELAIGGLYQVAVGGVMNETVAGAKTEEVGLAKAVFVG
NNMSENVKGDRTTNTNGNYTETISAKYYAKADEYVIEAPKITLKAGSSSIVMDGSSITIKASKIFQN
 
Nucleotide Sequence: 2094 bp     [Download]
>gi|39995111|ref|NC_002939.4|:3485350-3487443 Geobacter sulfurreducens PCA chromosome, complete genome
ATGACAATCCAAAAGGCCGCGGCAAGCCTCCTTTCTCAGGGCTCAACATCAAGCTTTCAGTTCGAGATTC
CCGCCACCAGGCACTTACTGTCGGTAGCGGGATTCACCGTCGACGAGCGTATATCCCATCCCTATGACAT
CCACCTCACCCTGGCCACAAAGGACAATGTGGATCTCGACGAGGTGATCGACAAGGAAGCCGTGCTTTCC
GTAGATCATGAGGGCGGAACGCGCTATTTCCACGGTGTTGTCCGGGAATTCACCTCTCTCGGGACGGACG
GCGACTACGACCTCTACCACGCCCACATTGTGCCGGCCCTGTGGTTCCTTTCGCTGGAGCAGGATTGCCG
TGTTTTCCAGTTCAAGAACGTTCAGGACATAGTCGCCGAAATCCTCGAAGAGAGTAATATCACCAGTGAC
CGCTACCGCTTCGCACTCTCCAGGGAGGACCGCCTGCGCAAATTCTGCGTCCAGTACCGGGAAACGGACC
TGAACTTTGTCTCGCGACTTCTCGAAGAGGAGGGAATCTTCTACTTTTTCGAGCACTACGAAGACAAGCA
CGTCATCGTCTTTTCCGACACCGGCTCAGGCTATCTCTACATGCCCGGCAAGCGCCAGATCCCCTTCAAC
ACCAATGACGGCATGGTGCCCGGAAAGGAGAGCGTCTTCGACTTCATCTACTCGCGCCGCGTTCGCCCCG
GCAAGGTGTCACAGCGCGATTATTGCTACAAGCACACGAACCTCGACTTGACCACCCAGCGGCAGGGAAA
GGTGTCCGCTCAGCGGGAGGTCTACGACTTCCCCGGCAATTACTTCAATGAGGAACGAGGTACCTATCTG
GCCAACGTCCGCCTGGAGCGATTGCTGGTGCTCGGCGCGACCGCAGAAGGGCAGAGTTCGTGCCCTCGCA
TGATGCCGGGACACGAGTGGGAACTTTCCGGCCACGATTATGCCGGGAAGTATCTGCCAGTGGCAGTCAT
CCATCATGGCGCTCAGCCCCAGGTGCTTGGCGAGCATGCCGGAGATGGCGGCTTTCGCTACGACAACGAA
TTTATCGCCGTGCCGGCCGCCGTAACGGTCCGCCCCCAGATTGTCGCCGGCAGGCCCGCCATCGTCGGAC
TCCAGACTGCCGTCGTTACCGGCTCGCCCGGCGAAGAAATCCACGCCGACCCCGACGGCTACCTGCGGGT
GAAAGTGCAGTTTCCCTGGGACCGGCGTGGCCGGAAGGATGGCAGGACCTCATGCTGGGTCAGGGTCGGC
CAGCCCTGGGGAGGCGGTGGATGGGGAACCCAGTTTCTGCCCCGTGTTGGAGACGAGGTGCTTGTCACGT
TCCTTGAAGGCGACCCCGACCGCCCCATGGTAATCGGCAGTGCGTACAACTCCGAAAATCAACCACTGTA
CGCTTTGCCCGCCAGTAAAACCCAGAGCGGCATCCGCACCCGCAGCTACCCAAACGGCGGTACTGACAAT
TTCCATGAACTCCGCTTCGAGGATAAGAAGGGAAGCGAGGAGATCTACCTGCAGAGCGAAAAGGACTGGA
ACATTCTGGTTAAAAACGACAAGGGGCAGACTGTCGGGCGGAACGAGAGCCTGACCGTCGGCAACAACCG
CTCAAAAACGGTGGGGGTGGATCAGAGCGAGAGTGTCGGTGTCAACAAGTCCATCCAGGTAGGGGCAAAC
CACAACGAAAGCATCGGCGCCAACATGACTCTGAGCGTAGGCGGTTTCAAGAATGAGACTGTCGGCATAA
ATTCACTCGAAACAATCGGCGGTGCAAAGGAGCTAGCCATTGGCGGCCTCTACCAAGTTGCGGTAGGCGG
CGTCATGAACGAGACGGTTGCCGGCGCCAAAACGGAAGAAGTCGGACTGGCAAAAGCGGTGTTCGTCGGC
AACAACATGAGTGAGAACGTAAAAGGTGACAGAACCACCAATACAAACGGCAACTACACGGAAACCATCA
GCGCCAAATATTACGCCAAAGCTGACGAATATGTCATCGAGGCGCCCAAAATCACGCTTAAGGCCGGTTC
TTCATCCATTGTCATGGATGGGAGCAGCATAACGATCAAGGCGAGCAAAATTTTCCAGAATTGA