SecReT6
Protein ID: 401764094
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13120
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2778869..2780791 [-]
Producthypothetical protein
NoteTssI
UniProt IDJ7GLQ2
KEGG IDeno:ECENHK_13120
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-76, Aligned region: 22..327
Phage_GPD [PF05954], Evalue: 1.40E-76, Aligned region: 509..558
Phage_base_V [PF04717], Evalue: 8.60E-26, Aligned region: 364..457
Gp5_C [PF06715], Evalue: 0.00045, Aligned region: 500..515
Gp5_C [PF06715], Evalue: 0.00045, Aligned region: 517..537
Protein Sequence: 640 a.a.     [Download]
>gi|401764094|ref|YP_006579101.1| hypothetical protein ECENHK_13120 [Enterobacter cloacae subsp. cloacae ENHKU01]
MLNRITVQLPVEGLLFWKLTGREAMSESFALTLTVLGTDARIDRSKLLGQPVTVTIPTQNLLTSRYVNGK
ITRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLAEHQVNVEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGIAYHFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHTFTLTNAPFFSDNGEYLVTAAGYHFEENRYASGEGETVHRTDFTVIPASVS
YRPAQSTAWPRTYGPQTAKVVGPNGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNDASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWIQAERNMDTSVKNDETHSVGGERSHYVKKNELHRVEANQTQAVKGGTEILTGKGKLDAAVEQYVIA
SGTKLRLVSGESAIELNANGKINLIGKEFNFFVEGDGYITTGGKLHLNTSGTKPGTTAPGSGHKGDIDAA
VQEKFTPKDE
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2780791-2778869 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGCTCAACCGAATTACCGTTCAGCTCCCGGTGGAGGGGCTTCTGTTCTGGAAACTGACGGGGCGCGAGG
CGATGTCCGAGTCGTTCGCGCTGACGCTGACCGTGCTCGGCACGGACGCGCGCATTGACCGCAGCAAACT
GCTGGGCCAGCCGGTCACGGTGACCATTCCGACGCAGAACCTGCTGACGTCCCGCTATGTTAACGGAAAA
ATTACCCGCGTGGCGGTGAGCGCCGTTGAGCTGACGGGCACTCGCTATGCGGTGTACCAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGAAGCGCGACCGTAACCTGCGTATTTTCCAGGGCCAGACGGTGCCGCAGAT
TGTGAAAACCCTGCTGGCTGAACATCAGGTCAACGTGGAGGATAAACTTACCGGCAGCTACCGGGTGTGG
GACTACTGCGTGCAGTATCAGGAGTCGAGCCTGGACTTCATCAGCCGCCTGATGGAGCTGGAAGGGATTG
CCTATCACTTCAGCCACGAGGCCGACAAGCACACCCTGGTGCTCACCGACGCCGCCACCCAGCATCAGCC
GTTCAGCGGCTATGAGGTCATTCCTTACCACCAGACGCCGTCCGGCGGCAGTACGGATGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGGATTTACAGCCTCGACGACTATGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCCCAGCAGAACCCGGCGTCGCCGAAGCCGGGCAGCATTGACGTCTACGA
CTGGCCGGGACGCTTTGTGGAGACCGGGCATGCGGAGTTTTACGCCCGCATTCGCCAGGAGCGCTGGCAG
GTTGAGCACCAGCAGATTCAGGCCACCGCCACGGCGGCGGGGATTGCGCCGGGCCACACCTTCACCCTGA
CCAACGCGCCGTTCTTCAGCGATAACGGCGAGTATCTGGTGACGGCGGCGGGCTACCACTTCGAAGAGAA
CCGTTACGCCAGCGGCGAAGGTGAAACTGTTCACAGGACCGATTTCACGGTCATCCCGGCGTCGGTCTCT
TATCGCCCGGCGCAGAGCACGGCGTGGCCGCGCACCTACGGCCCGCAGACGGCGAAGGTGGTGGGCCCGA
ACGGCGAGAGTATCTGGACCGACAAATACGGTCGCGTGAAGGTGAAGTTCCACTGGGACCGTCTGGCGAA
GGGGGATGACACCAGCTCCTGCTGGGTGCGCGTGTCGAGCGCGTGGGCGGGCCAGGGCTACGGCGGGGTG
CAAATCCCGCGCGTCGGCGACGAGGTGGTGGTGGACTTTATCAACGGCGACCCGGACCGTCCGATTATTA
CCGGGCGCGTGTACAACGACGCGAGCATGCCGCCGTGGGCGCTGCCGGCGGCGGCGACGCAGATGGGCTT
TATGAGCCGCACGAAGGACGGCTCCGTGGACAATGCCAACGCCCTGCGCTTTGAGGATAAAGCAGGTGCA
GAGCAGGTGTGGATCCAGGCCGAGCGCAACATGGACACCAGCGTTAAAAACGATGAAACGCACAGCGTCG
GTGGCGAGCGCAGCCATTACGTTAAGAAAAATGAACTGCATCGTGTGGAAGCTAACCAGACGCAGGCCGT
CAAAGGTGGGACTGAGATCCTGACCGGCAAAGGCAAGCTGGATGCGGCGGTGGAGCAGTACGTCATTGCT
TCCGGGACGAAGCTGCGGCTGGTCTCAGGGGAAAGCGCCATTGAGCTGAATGCTAACGGCAAGATTAACC
TGATCGGTAAAGAGTTTAACTTCTTCGTGGAAGGGGATGGTTATATCACCACGGGCGGTAAGCTGCACCT
GAATACCTCGGGAACCAAGCCGGGCACTACGGCACCGGGATCGGGGCATAAAGGGGATATTGATGCGGCT
GTGCAGGAGAAATTTACGCCAAAAGATGAGTAA