SecReT6
Protein ID: 401764100
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13150
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2787260..2789131 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDJ7GH23
KEGG IDeno:ECENHK_13150
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-209, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|401764100|ref|YP_006579107.1| type VI secretion system protein ImpG [Enterobacter cloacae subsp. cloacae ENHKU01]
MESKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYTERLMEGFAFLTSRVQMKMDAEFPR
FSQRLLEMIAPNYLAPTPSMAIAQIEPDSSRGDLSNGFIVPRGTMMDSLALKKTGVTCSYTTAHEVNLLP
LKIDNVELGGVPADLPLAQLGLSQRGINSALRIRIACDGPQNLGHLNFDQLTFFLSGPDIEALKLLELVM
EHHAGIVCQTVSPQPQRQLLASDALCQEGFAADQALLPDDLRNFDGYRLLQEYFAFPARFRFISLSGLST
LLQRCEGEKAFDIFILLDKSDEQLERVVDASHLALHCTPVINLFPKVAARQKLNEGQHEYHLVVDNIRPL
DYEIYAVNKIFGSADGQRDDQTFRPFWSTWSGDAGNYGAYFSLRREQRVLSEHAQRYGTRTGYIGSEVFV
SLVDEQHAPWQENLRYISAEVLCTSRDLPLMLQQELGQFIMADSMPVKSLTLRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDSENEEGAAALRQLLGLYANLAETAVARQVEGVRHCVLEPVHRRVPEPGPVVFARG
IGITLTVDERAFSGASPWLFGSVLERLFARLVSINSFTEFTLKSQQRGEIGYWAPRMGKRALV
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2789131-2787260 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGAAAGTAAACTGCTCGAATACTACAACCGTGAGCTGGCCTACCTGCGTGAAATGGGGGCCGAGTTTG
CCGAGCGCTACCCAAAAGTCGCCGGACGACTGGGCATGCGCGGCATTGAAGTGGCGGACCCGTACACGGA
ACGCCTGATGGAAGGTTTCGCTTTTCTGACCTCCCGCGTGCAGATGAAAATGGATGCCGAGTTTCCGCGT
TTCTCCCAGCGTCTGCTGGAGATGATCGCGCCGAATTACCTCGCGCCAACCCCATCAATGGCGATTGCGC
AAATCGAGCCCGACAGCAGCCGGGGCGACCTGAGCAATGGCTTTATTGTGCCGCGCGGCACCATGATGGA
CAGCCTGGCGCTGAAAAAGACCGGCGTAACCTGCAGCTATACTACGGCGCACGAGGTTAATCTGCTGCCG
CTGAAAATTGACAACGTGGAGCTGGGCGGCGTGCCTGCTGACCTGCCGCTGGCACAGCTGGGGTTAAGCC
AGCGGGGGATCAACAGCGCGTTGCGGATCCGCATTGCCTGCGACGGCCCGCAAAACCTCGGCCATCTGAA
TTTCGACCAGCTGACGTTTTTCCTCAGCGGCCCGGACATTGAAGCGCTGAAGCTGCTGGAGCTGGTGATG
GAACATCACGCCGGGATCGTCTGCCAGACGGTCAGCCCGCAACCTCAGCGACAGCTGCTGGCGTCGGATG
CCCTGTGTCAGGAGGGCTTTGCCGCGGATCAGGCACTGCTCCCGGACGATCTGCGCAACTTTGACGGTTA
TCGTCTGCTGCAGGAGTATTTCGCGTTCCCAGCCCGTTTCCGCTTCATCAGCCTGAGCGGCCTGAGCACG
CTGCTCCAGCGCTGTGAAGGCGAAAAAGCCTTCGATATCTTCATCCTGCTGGATAAATCAGATGAACAGC
TGGAGCGCGTGGTGGATGCCAGCCATCTGGCGCTGCACTGCACGCCAGTCATCAACCTGTTCCCGAAGGT
GGCGGCGCGTCAAAAGCTGAATGAAGGCCAGCACGAATACCATCTGGTGGTCGATAACATCCGCCCGCTG
GATTATGAAATTTACGCGGTGAATAAAATCTTCGGCAGCGCGGACGGTCAGCGTGACGACCAGACGTTTC
GTCCTTTCTGGAGCACCTGGAGCGGGGATGCGGGCAACTACGGAGCCTATTTTTCCCTGCGCCGGGAACA
GCGCGTGCTCTCTGAGCATGCCCAGCGCTACGGCACCCGTACCGGCTATATCGGTTCAGAGGTGTTTGTT
TCGCTGGTGGATGAACAGCACGCCCCGTGGCAGGAAAACCTGCGCTACATCTCTGCCGAGGTGCTCTGCA
CCAGCCGCGACCTGCCGCTGATGCTACAGCAGGAGCTTGGGCAGTTCATCATGGCCGACTCCATGCCGGT
GAAATCGTTGACCCTGCGTAAAGGCCCGACGCCACCGCGTCCGGCGCTGGCAGAAGGGTTCAGCACCTGG
CGGCTTATCAGCCAGCTGCAGATGAACTACCTCAGCCTGATGGACAGCGAGAATGAAGAGGGGGCTGCCG
CGCTTCGTCAGCTGTTAGGGCTGTATGCCAACCTGGCCGAAACGGCCGTGGCGCGTCAGGTGGAGGGGGT
TCGCCACTGCGTGCTGGAGCCGGTTCACCGCCGCGTGCCTGAACCCGGTCCGGTCGTTTTCGCCCGCGGA
ATCGGCATTACCCTGACCGTAGACGAGCGGGCGTTTTCCGGTGCCAGCCCGTGGCTTTTCGGCAGCGTGC
TGGAACGCCTGTTTGCCCGACTGGTATCCATCAACAGTTTTACTGAGTTCACCCTGAAGAGTCAGCAGCG
CGGCGAGATCGGCTACTGGGCACCGAGAATGGGTAAAAGGGCGCTGGTATGA