SecReT6
Protein ID: 401764101
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13155
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2789134..2789697 [-]
Producthypothetical protein
NoteTssE
UniProt IDJ7GCM4
KEGG IDeno:ECENHK_13155
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 56..166
Protein Sequence: 187 a.a.     [Download]
>gi|401764101|ref|YP_006579108.1| hypothetical protein ECENHK_13155 [Enterobacter cloacae subsp. cloacae ENHKU01]
MSNPAGEGDLLRSGWQARSKQDKVGARDKMQPSLLDRLTDNDPEKKREPANSNLITHAALRRNVLRDLQW
LFNTINHDASGDLSALPQVSRSVINFGVAPLAGKRMSDIEWHDIQRKLTEAIINFEPRILPQGLQVRCVS
DTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 564 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2789697-2789134 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAGTAATCCCGCTGGCGAAGGCGATCTGCTGCGCAGCGGCTGGCAGGCCCGCAGCAAGCAGGATAAGG
TGGGGGCGCGCGACAAAATGCAGCCCTCGCTGCTGGATCGCCTTACGGATAACGACCCGGAAAAAAAGCG
TGAGCCAGCCAACAGTAATCTGATCACCCACGCTGCGCTGCGTCGCAATGTCCTGCGGGATTTGCAGTGG
CTGTTTAATACCATCAACCATGATGCCTCCGGCGATCTGAGCGCCTTGCCGCAGGTGAGCCGCTCGGTGA
TCAACTTCGGCGTCGCGCCGCTCGCAGGTAAGCGAATGTCAGATATCGAATGGCACGATATTCAGCGCAA
GCTCACCGAGGCCATCATCAATTTTGAACCGCGCATTTTGCCGCAGGGATTGCAGGTGCGCTGCGTGTCG
GATACCTCCTCGCTGGATCTGCACAACGTGCTCTCCATTGAGATAAAAGGGCGTTTATGGTGTGTTCCGT
ACCCGCTGGAGTTTCTGTTTCGCACCGATGTCGATCTGGAAAACGGCCATTTTGAACTGAAAGATGCGGG
GTAA