SecReT6
Protein ID: 401764102
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13160
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2789690..2790502 [-]
ProductVirulence protein SciE Type
NoteTagJ
UniProt IDJ7GJ95
KEGG IDeno:ECENHK_13160
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.50E-42, Aligned region: 140..263
TPR_19 [PF14559], Evalue: 0.00044, Aligned region: 12..68
TPR_19 [PF14559], Evalue: 0.00044, Aligned region: 76..119
TPR_16 [PF13432], Evalue: 0.0086, Aligned region: 13..64
TPR_16 [PF13432], Evalue: 0.0086, Aligned region: 104..121
Protein Sequence: 270 a.a.     [Download]
>gi|401764102|ref|YP_006579109.1| Virulence protein SciE Type [Enterobacter cloacae subsp. cloacae ENHKU01]
MNTLYQQLAGETLNDALARLEAGIKARPADADLRAAFVQFLTLSGNWTRALTQLKSWLALKPQAKPTVTL
LEQAIQGELQRAQVMAGQARPAMPESQWPWLTTLAAALNEEGERAQALRLEALEQAQATAGHIILENEET
QAFDWLMDGDARLGPVCETLVNGRYFWLPFNAIAEIRFQAPASVTDLVWRHALVRLTDGTEQVCQIPARY
PFAADAPDAVKLGRTTEWHPLDESGTLYEGLGQKAWLSEQSESPLLSLSLVTFATDGADE
 
Nucleotide Sequence: 813 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2790502-2789690 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAATACGCTCTATCAACAGCTGGCGGGTGAAACGCTCAATGACGCGCTGGCGCGTCTGGAAGCCGGGA
TCAAAGCCCGTCCGGCAGATGCCGACCTTCGCGCCGCGTTCGTGCAGTTTTTAACCCTCAGCGGCAACTG
GACCCGGGCGCTGACCCAGCTGAAAAGCTGGCTGGCGCTGAAGCCTCAGGCGAAGCCGACCGTCACACTG
CTGGAGCAGGCCATTCAGGGTGAGCTGCAGCGTGCGCAGGTGATGGCGGGCCAGGCGCGTCCAGCCATGC
CTGAATCTCAGTGGCCGTGGCTGACCACGCTTGCCGCCGCGCTTAACGAAGAGGGCGAGCGTGCCCAGGC
GTTGCGTCTGGAAGCCCTTGAACAGGCGCAGGCAACGGCGGGACACATCATCCTTGAAAACGAGGAGACG
CAGGCGTTTGACTGGCTGATGGACGGTGATGCCCGTCTTGGTCCGGTGTGCGAAACCCTTGTTAACGGAC
GCTATTTCTGGCTGCCGTTTAACGCTATTGCGGAGATCCGTTTCCAGGCGCCCGCCAGCGTGACCGATCT
GGTCTGGCGTCATGCGCTGGTCCGTCTTACCGACGGTACCGAGCAGGTGTGCCAGATCCCGGCGCGCTAT
CCTTTTGCGGCTGATGCCCCGGATGCGGTCAAACTGGGGCGCACTACCGAGTGGCATCCGCTTGATGAGA
GCGGAACGCTGTATGAAGGGCTGGGTCAAAAAGCCTGGCTGAGCGAGCAAAGCGAAAGCCCGCTGCTGTC
GTTAAGCCTCGTGACGTTTGCGACGGACGGAGCCGATGAGTAA