SecReT6
Protein ID: 401764105
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13175
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2792315..2794015 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDJ7GH28
KEGG IDeno:ECENHK_13175
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-09, Aligned region: 9..75
UreE_N [PF02814], Evalue: 0.0029, Aligned region: 10..31
UreE_N [PF02814], Evalue: 0.0029, Aligned region: 60..81
Protein Sequence: 566 a.a.     [Download]
>gi|401764105|ref|YP_006579112.1| FHA domain-containing protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MIFYAPGGTIGRGTDNNLVLPDNDRTISRLQAIVHVDANGECRVTNRGSVTRVVLNDIPLERGRQVELQD
GDILGIDDYRIEVAELIHDTQPVSRMAASMQQQAHPTAAPAPASQPKPANPAPRGKAEPTAVPSEIWDSL
MQEFSISDSISSNRAKPQSAASQDPFSQPAAPERNAEDPLAMFNDSDPTLERKNVDPDTLFGEETLFKKE
SIFDDVTPSTLVPPVETQPAPKEEAVDELDPLALFGGKASAPAARNDDPLGLMGGAPLTHPDDITDEKPA
PEPEQEEDVLAGSPLFAPEPQETPRAEEEPVRPDYAGFTMPTPQAVARSSAQTPKGRLRIDPVNNAASPS
ATANTGEKGDVLQGELLQALLEGMGLSEMQPVPQFDRENMRQLGQILGMFSQGTVALLSSRSILKRGVKA
DMTMVLDDANNPFKLLPTGKTVLIQMFGTPMPGFMPPTKSVRDALIDLQAHQLGMISGIRAIIAAMLQSF
NPEQLEEQAKQNGMTSRLALPGSRKAALWDYFVRSYGETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQ
SGSEDK
 
Nucleotide Sequence: 1701 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2794015-2792315 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
GTGATTTTTTATGCCCCGGGCGGCACCATTGGGCGCGGTACGGATAACAATCTGGTGTTGCCGGACAATG
ACCGCACCATCTCGCGCCTGCAGGCCATTGTTCACGTTGACGCCAATGGTGAATGTCGCGTCACTAACCG
TGGCAGCGTCACCCGCGTGGTATTAAATGATATTCCGCTGGAGCGGGGGCGTCAGGTTGAACTGCAGGAT
GGCGACATTCTCGGTATTGATGACTACCGTATCGAAGTGGCCGAACTTATCCACGACACGCAGCCGGTGA
GCCGCATGGCCGCCAGCATGCAGCAGCAGGCGCATCCGACAGCCGCGCCAGCGCCAGCATCGCAACCGAA
GCCTGCGAACCCTGCGCCACGCGGTAAAGCGGAACCGACTGCCGTGCCGTCGGAAATCTGGGATAGCCTG
ATGCAGGAGTTTTCTATCTCCGACAGCATCTCCAGCAACCGTGCAAAACCGCAGTCAGCGGCTTCGCAGG
ATCCGTTCTCTCAGCCTGCGGCGCCGGAGCGTAATGCTGAAGATCCGCTGGCGATGTTCAACGACAGCGA
TCCCACGCTTGAGCGTAAGAATGTCGACCCGGACACGCTGTTCGGCGAAGAAACGCTGTTCAAAAAAGAG
AGCATTTTCGACGACGTGACGCCTTCCACACTGGTGCCACCTGTTGAGACTCAACCCGCCCCTAAAGAAG
AGGCGGTAGATGAACTCGATCCGCTGGCGCTATTTGGTGGCAAGGCCAGCGCGCCGGCTGCACGCAATGA
TGACCCGCTCGGGCTGATGGGCGGGGCGCCGTTAACCCATCCGGATGACATCACTGACGAAAAGCCAGCG
CCTGAGCCTGAGCAGGAGGAAGACGTCCTTGCCGGTTCCCCGCTTTTTGCCCCTGAGCCGCAGGAAACGC
CGCGTGCAGAAGAGGAGCCGGTGAGACCAGATTACGCAGGTTTCACGATGCCTACGCCGCAGGCCGTTGC
GCGCAGCAGCGCTCAGACCCCTAAGGGCCGACTGCGTATCGATCCGGTTAATAACGCTGCCTCGCCATCG
GCTACCGCGAACACTGGAGAGAAGGGCGATGTGTTGCAGGGGGAACTGCTGCAGGCACTGCTGGAAGGGA
TGGGGCTGAGCGAAATGCAGCCTGTCCCGCAGTTTGACCGGGAAAATATGCGTCAGCTGGGGCAGATCCT
CGGCATGTTCTCTCAGGGCACCGTGGCGCTGCTCTCCTCGCGCTCTATTCTTAAACGCGGCGTAAAAGCC
GATATGACCATGGTGCTGGACGATGCCAACAACCCGTTCAAGCTGTTGCCGACCGGGAAAACGGTTCTGA
TCCAGATGTTCGGCACCCCGATGCCGGGCTTTATGCCGCCAACGAAATCCGTGCGCGATGCCTTGATCGA
TCTGCAGGCGCACCAGCTGGGCATGATCTCCGGCATCCGCGCTATTATTGCCGCGATGCTGCAGTCCTTC
AATCCCGAACAGCTGGAAGAGCAGGCGAAGCAAAACGGCATGACCTCGCGTCTGGCGCTGCCGGGCAGCC
GTAAAGCCGCCCTGTGGGACTATTTTGTTCGCAGCTATGGCGAGACGGCGGGCGAGATTGAGGATGACTT
CCACACCCTGTTCGGCGAAGCCTTCCTTCATGCGTATGACATGGAGGTGAATCAGTACAAAGACTCACAG
AGCGGATCGGAAGACAAATGA