SecReT6
Protein ID: 401764110
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13210
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2797795..2799294 [-]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDJ7GH33
KEGG IDeno:ECENHK_13210
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|401764110|ref|YP_006579117.1| type VI secretion system protein ImpC [Enterobacter cloacae subsp. cloacae ENHKU01]
MSNQTQQHEQQAGQAFSQDEFSALLNKEFRPKTDQARSAVESAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEQLSQQVNQIIHHEEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRFKGVGWDQS
PIFKKIYEQEYGQFGGEPFGCIVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHNSYSWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFREREEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKTKDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2799294-2797795 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAGCAACCAGACTCAACAACATGAGCAGCAGGCGGGTCAGGCCTTCAGCCAGGATGAATTCAGCGCGC
TGCTGAACAAAGAGTTCCGCCCGAAAACCGATCAGGCGCGTTCTGCCGTTGAAAGCGCGGTCAAGACCCT
GGCACAGCAGGCGCTGGAGAATACCGTTACCTTCTCTAACGATACCTATCGCACCATTCAGAACCTGATT
GCCGGTATCGACGAACAGCTCTCTCAGCAGGTGAACCAGATCATTCACCACGAAGAGTTTCAGAAGCTGG
AGAGCGCCTGGCGCGGTCTGAGCTACCTGGTGAACAACACCGAAACTGACGAGATGCTGAAGATCCGCTT
TATGAGCATCTCCAAGCAGGAGCTGGGCCGTACCCTGAAGCGCTTCAAGGGCGTGGGCTGGGACCAGAGC
CCGATCTTCAAGAAAATCTACGAGCAGGAGTATGGTCAGTTTGGCGGCGAGCCGTTTGGCTGCATCGTGG
GCGACTACTACTTCGACCACAGCCCGCAGGACGTTGAGCTGCTGGGCGAAATGGCGCGCATCGGCTCTGC
GGCACACTGTCCGTTCATCACCGGTACCGCACCGGGCGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCT
AACCCGCGCGACCTGACCAAAATCTTCCAGAATACCGAATACGCGGCCTGGCGTTCACTGCGTGAATCTG
AAGATGCCCGCTACCTGGGGCTGGTGATGCCGCGCTTCCTGTCGCGCCTGCCGTATGGCATCCGCACTAA
CCCGGTCGACAGCTTTGATTTTGAAGAGCAGACCGACGGCGCAAACCACAACAGCTATTCGTGGGCGAAC
GCCGCCTATGCGATGGCGGCCAACATCAACCGCTCCTTCAAAGAGTACGGCTGGTGCACCTCGATTCGCG
GCGTGGAGTCCGGTGGGGCAGTCGAAAACCTGCCGTGCCACACCTTCCCAAGCGATGACGGCGGCGTGGA
CATGAAATGCCCGACCGAGATCGCCATCAGCGACCGCCGCGAAGCCGAGCTGGCGAAAAACGGCTTCATG
CCGCTGGTTCACCGTAAAAACTCTGATTTTGCCGCCTTCATTGGCGCGCAATCTCTGCAAAAACCGGCCG
AGTACCACGATCCGGATGCCACTGCGAATGCGCGTCTGGCCTCTCGTCTGCCGTACCTGTTCGCCTGCTG
CCGCTTTGCCCACTATCTGAAGTGCATCGTGCGCGACAAAATCGGCTCCTTCCGCGAGCGCGAAGAGATG
GAACGCTGGCTGAACGACTGGGTAATGAACTACGTGGACGGTGACCCGGCGAACTCCTCTCAGGAAACCA
AGTCCCGTAAACCGCTGGCGGCTGCGGAAGTGCAGGTGCAGGAGATTGAAGACAACCCGGGTTACTACGC
CGCGAAGTTCTTCCTGCGTCCACACTACCAGCTGGAAGGCCTGACCGTTTCCCTGCGTCTGGTTTCTAAA
CTGCCGTCGCTGAAGACGAAAGACGCGTGA