SecReT6
Protein ID: 401764111
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13215
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2799298..2799822 [-]
Producthypothetical protein
NoteTssB
UniProt IDJ7GCN5
KEGG IDeno:ECENHK_13215
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-61, Aligned region: 11..162
Protein Sequence: 174 a.a.     [Download]
>gi|401764111|ref|YP_006579118.1| hypothetical protein ECENHK_13215 [Enterobacter cloacae subsp. cloacae ENHKU01]
MAMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVENLPAVDDRKFLEIDIDNF
DERMKALKPRVAFQVDNTLTGEGKLNVDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYMDGKN
GAEELIAKILQDPTLLKSLSQLPKNDDSAKGSEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2799822-2799298 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGCAATGAGTAACAGTGGGCAGAAATTCATCGCACGTAACCGTGCCCCCCGCGTGCAGATCGAGTACG
ACGTAGAGATCTACGGTGCAGAACGTAAGATTCAGCTGCCGTTTGTGATGGGCGTCATGGCCGATCTGGT
CGGTAAACCGGTGGAAAACCTGCCGGCGGTCGACGATCGCAAATTCCTTGAAATCGACATCGACAACTTT
GACGAACGCATGAAGGCGCTGAAGCCGCGCGTGGCGTTCCAGGTGGATAATACCCTTACCGGCGAAGGTA
AGCTCAACGTCGATCTGACCTTCGACAGCATGGACGACTTCCTGCCGGACGCGGTGGCCCGCAAGGTGGA
GCCGCTGAACAAGCTGCTGGAAGCACGTACTCAGCTCTCCAACCTGCTGACCTACATGGACGGCAAAAAC
GGCGCGGAAGAGCTGATCGCAAAAATTCTGCAGGATCCGACGCTGCTCAAATCTCTGAGCCAGTTGCCGA
AAAATGACGACAGTGCGAAAGGTAGCGAGGAATAA