SecReT6
Protein ID: 401764112
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13220
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2799898..2800914 [-]
Producthypothetical protein
NoteTssA
UniProt IDJ7GJA5
KEGG IDeno:ECENHK_13220
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-19, Aligned region: 52..111
Protein Sequence: 338 a.a.     [Download]
>gi|401764112|ref|YP_006579119.1| hypothetical protein ECENHK_13220 [Enterobacter cloacae subsp. cloacae ENHKU01]
MNIEEFLAPISPDKPCGDNLEYDADFQVMNQASQGKAEQQFGDTIIPAEPADWNTVEKYATSLLARTKDL
RVMLALTHAWTRRRGLAGYADGLLLVQEALARYWEPLYPLLEEYGETDPFYRINALAGLSDKSELTIAVR
NASLLRSNGDEISLRDAQALLDGSKTECPDYPGGRPRLIDELARGDQPGTAAVIVINERLLAIRALLTGY
LGESGVPEMEQLLKTTGLVASACQVTDISKLLPGREAQAEPQADHQPAATQPAQPVTDWRSVQVTSRADA
QLMLEKAKQYFAQYEPSHPAPLMIERVQRLSELNFMDIIRDLAPDGVNQLENIFGRRE
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2800914-2799898 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAATATCGAAGAATTTCTCGCGCCCATAAGCCCGGATAAACCCTGTGGCGACAATCTGGAATACGACG
CTGACTTCCAGGTGATGAACCAGGCAAGCCAGGGGAAAGCGGAACAGCAGTTTGGCGACACCATTATCCC
GGCAGAGCCTGCTGACTGGAACACGGTAGAAAAATACGCCACCAGCCTGCTGGCGCGCACGAAAGATTTG
CGCGTGATGCTGGCGCTAACCCATGCGTGGACACGCCGCCGCGGGCTGGCAGGCTACGCAGACGGGCTGC
TGCTGGTGCAGGAGGCGCTCGCGCGCTACTGGGAGCCGCTCTATCCGCTTCTGGAGGAGTATGGCGAAAC
CGACCCGTTCTATCGGATTAATGCCCTGGCGGGGCTGAGCGATAAATCTGAACTCACCATTGCGGTACGC
AACGCCTCGCTGCTGCGTTCAAACGGCGATGAAATTTCGCTGCGGGACGCCCAGGCACTGCTGGACGGCA
GTAAAACTGAATGCCCGGACTATCCGGGGGGCCGTCCAAGATTGATTGACGAACTGGCCCGCGGCGATCA
GCCAGGGACTGCCGCGGTAATCGTGATTAACGAGCGGTTGCTGGCCATCCGCGCGCTGCTTACCGGATAT
CTCGGTGAAAGCGGTGTACCCGAGATGGAGCAACTGCTGAAGACCACAGGACTGGTCGCCAGTGCCTGTC
AGGTGACCGACATCAGCAAGCTGTTGCCGGGCCGTGAGGCGCAGGCTGAACCGCAAGCCGATCATCAACC
TGCGGCAACGCAACCCGCTCAGCCGGTTACCGACTGGCGCAGCGTGCAGGTCACCAGCCGTGCCGATGCG
CAGCTGATGCTGGAAAAAGCAAAACAGTATTTTGCGCAGTACGAACCGAGCCACCCCGCACCGCTGATGA
TTGAACGGGTGCAGCGGCTGTCAGAACTTAACTTTATGGACATTATTCGCGACCTGGCGCCAGACGGCGT
TAACCAACTGGAAAACATCTTTGGACGCCGCGAATAA