SecReT6
Protein ID: 401764115
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13235
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2805282..2806520 [-]
Producthypothetical protein
NoteTssL
UniProt IDJ7GH38
KEGG IDeno:ECENHK_13235
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-69, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 1.60E-69, Aligned region: 369..389
OmpA [PF00691], Evalue: 4.60E-14, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|401764115|ref|YP_006579122.1| hypothetical protein ECENHK_13235 [Enterobacter cloacae subsp. cloacae ENHKU01]
MQERQDTGSDAAFTGASSNNQLVAAANPLLNAIPQIRHSVSHDDQVALRQRLIDEIRRFEVRCQQAGLPY
EVIVGARYCLCTALDEAAALTPWGSSGVWSSNGLLVTFHNETWGGEKFFQLLARLSQNPREHILLLEMIN
YCLLLGFEGRYRVLDNGRTQLETIKQRLWQMIRGVRGSYPPPLSPHPEDRPVLRKLWRPMVPLWACVALA
GFIACLFYIVLNWRLGDNTSPVLAKIYQSQLPETTIQQPARQLPAVLNLRGFLKPEIEAGLVAVKDEADR
SVVILKGDGLFASASTVVRDRYEPVVNRIAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLERARSV
QKMLQGSLSQPDRVKAEGRGEINPVAPNTTPENRARNRRVEITLLVSPENTQAELNGLPQGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2806520-2805282 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGCAGGAACGACAGGATACCGGCAGTGATGCCGCGTTTACCGGAGCCAGTAGCAACAATCAGCTGGTGG
CGGCCGCTAATCCGCTGCTCAATGCGATTCCGCAGATCCGTCATTCGGTTTCACATGACGATCAGGTGGC
GTTACGCCAGCGCCTGATCGATGAGATTCGCCGTTTTGAAGTCCGCTGTCAGCAGGCGGGGCTACCCTAC
GAAGTGATCGTCGGGGCGCGTTACTGCCTTTGCACGGCGCTGGATGAGGCCGCTGCGCTTACCCCCTGGG
GCAGCAGCGGCGTCTGGTCAAGCAATGGCCTGCTGGTGACGTTCCATAACGAAACCTGGGGCGGCGAGAA
GTTTTTCCAGCTGCTGGCGCGTCTGTCGCAGAACCCGCGCGAACATATCCTGCTGCTGGAGATGATCAAC
TACTGCCTGCTGCTCGGTTTCGAAGGGCGTTACCGTGTGCTGGACAATGGTCGCACCCAGCTTGAGACCA
TCAAGCAGCGGCTGTGGCAGATGATTCGCGGCGTGCGGGGCAGCTATCCGCCACCGCTGTCTCCCCACCC
GGAAGATCGCCCGGTGCTGCGTAAGCTGTGGCGGCCGATGGTTCCCCTGTGGGCCTGCGTGGCGCTGGCC
GGGTTTATCGCCTGCCTGTTTTATATCGTCCTTAACTGGCGTCTTGGCGATAACACCAGTCCGGTCCTGG
CGAAGATTTATCAGTCCCAGCTGCCGGAAACCACCATTCAGCAACCGGCCCGTCAGTTGCCCGCAGTGCT
AAACCTGCGCGGCTTCCTGAAGCCTGAAATCGAGGCAGGTCTGGTCGCGGTAAAAGATGAAGCGGATCGC
AGCGTCGTTATCCTGAAAGGAGACGGGCTGTTTGCCTCCGCCTCGACGGTGGTGCGTGACCGTTATGAAC
CGGTTGTTAACCGCATAGCGCAGGCGATGAACAACGTCAGCGGCAAAATTCTGGTGGTGGGATACAGCGA
CAACGTTCCAATCCGCAGCGCGCGCTTCGCTTCCAACTATGAGCTTTCTCTGGAACGCGCCCGCTCGGTA
CAGAAAATGCTTCAAGGAAGCCTCTCTCAGCCAGACCGCGTGAAAGCGGAAGGGCGGGGTGAGATTAACC
CGGTAGCACCGAACACGACGCCGGAAAACCGCGCCCGTAACCGCCGTGTGGAAATTACTCTGCTGGTGTC
GCCTGAAAACACTCAGGCTGAGCTGAACGGATTGCCGCAAGGAAACTAA