SecReT6
Protein ID: 401764116
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13240
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2806538..2807881 [-]
Producthypothetical protein
NoteTssK
UniProt IDJ7GCP1
KEGG IDeno:ECENHK_13240
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.70E-138, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|401764116|ref|YP_006579123.1| hypothetical protein ECENHK_13240 [Enterobacter cloacae subsp. cloacae ENHKU01]
MTKAEKVVWTEGMFLRPHHFQRTESYLLNHVREWGALQRSYLWGFLDVELDEAMLRQGCIALSYCSGLLP
DGTFFQVRNGRNGPVPLKIPDNLTNEKVVLALPVRRGEREEVIFSEEPASLARFIAFEQEVEDDNAMSVG
DATVQFGRLRLTLMLEKDLTAEWTAIGVAFVTEKRHDNHVRLDNSYIPPMLNANNSPQIYSMINDLHGLL
VQRSQQIGGRLRQPGRFNTSELIEFTLLSLVNRHLGEVSHLKTLPLLHPETLWRSWLPFASELATWTPQR
TTESVLPVYDHDDLANCFSKLMLMLRQGLSLVMEDHAIQLPLNERSHGLNIATVPETSMVREFGFVLAVK
ANVPGEHLQTHFPAQMKIAPVSKIRDLVQLQLPGIMLRAMPVAPPQIPWHAGYSYFELEKGSELWHEMDK
SGAFALHLAGEFPGLDMEFWAIRSPTE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2807881-2806538 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGACGAAAGCAGAAAAGGTCGTCTGGACCGAAGGCATGTTCCTGCGTCCACACCATTTTCAGCGGACTG
AAAGTTATCTGCTCAACCACGTTCGTGAATGGGGTGCGTTGCAGCGTTCCTATCTTTGGGGCTTTCTTGA
TGTTGAACTCGACGAAGCGATGCTTCGTCAGGGATGCATTGCCCTGAGCTACTGCAGTGGGCTTCTGCCA
GACGGGACTTTCTTCCAGGTACGCAACGGACGCAATGGTCCTGTGCCGCTTAAAATCCCTGACAATCTCA
CCAACGAAAAGGTGGTGCTCGCACTGCCGGTACGTCGTGGCGAGCGGGAAGAGGTGATCTTCAGCGAAGA
GCCGGCCTCGCTGGCGCGCTTCATCGCGTTCGAGCAAGAGGTCGAAGACGACAACGCCATGTCGGTGGGG
GATGCCACCGTACAGTTTGGCCGCCTGCGCCTGACGCTGATGCTGGAAAAAGATCTCACGGCAGAATGGA
CCGCCATCGGCGTGGCGTTTGTCACTGAAAAACGCCACGACAACCACGTCCGGCTCGATAACAGCTACAT
CCCGCCGATGCTGAACGCCAATAACAGTCCGCAGATCTACAGCATGATTAACGATCTGCACGGCTTACTG
GTGCAGCGCAGCCAGCAGATCGGCGGCCGTCTGCGCCAGCCTGGCCGTTTTAACACCTCGGAACTGATTG
AATTTACGTTACTGTCGCTGGTGAACCGTCATCTTGGCGAGGTTTCGCATTTAAAAACGCTGCCGCTGCT
GCACCCGGAAACCCTCTGGCGCAGCTGGCTGCCGTTTGCGTCCGAGCTTGCCACCTGGACCCCACAACGG
ACCACGGAGAGCGTGCTGCCGGTCTACGATCACGACGATCTGGCGAACTGCTTCAGTAAGCTGATGCTGA
TGCTGCGTCAGGGGTTGTCGCTGGTGATGGAAGACCACGCTATTCAGCTGCCGCTTAACGAGCGCTCGCA
TGGTCTTAACATTGCCACCGTTCCTGAAACCAGCATGGTACGCGAGTTTGGCTTCGTGCTGGCCGTCAAA
GCGAATGTGCCCGGCGAACACCTGCAAACCCATTTCCCTGCGCAGATGAAAATCGCGCCGGTGTCGAAAA
TCCGCGATCTGGTCCAGCTTCAGCTGCCGGGCATTATGCTGCGCGCCATGCCGGTCGCGCCGCCGCAGAT
CCCGTGGCATGCAGGCTACAGCTATTTCGAGCTGGAGAAGGGCAGCGAGCTGTGGCACGAGATGGATAAG
TCCGGCGCCTTCGCCCTGCACCTGGCAGGGGAGTTCCCGGGGCTGGATATGGAGTTTTGGGCCATCCGTA
GCCCGACAGAATAA