SecReT6
Protein ID: 401764117
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13245
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2807910..2808413 [-]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDJ7GJA9
KEGG IDeno:ECENHK_13245
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.60E-31, Aligned region: 19..149
Protein Sequence: 167 a.a.     [Download]
>gi|401764117|ref|YP_006579124.1| type VI secretion system protein VasD [Enterobacter cloacae subsp. cloacae ENHKU01]
MNNKNFHKLWLVFYAAVFALVSGCTSSSHSDPSRYNLQFQAHPQINDSAPLKVRVLLLKSDADFMSSDFY
SLQNNASATLGANLLNSDVFFLMPGQLSKTLSGQSDPEARYIGVMAEYQKLDGKKWRVSLPLPVPGENHI
YQFWKWSADELQANVFLDVNGIRVISQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2808413-2807910 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAATAATAAAAATTTTCATAAGCTGTGGTTGGTCTTTTACGCGGCGGTTTTCGCCCTTGTGAGTGGTT
GTACGTCGTCTTCACACAGCGACCCCTCCCGCTACAATCTGCAGTTTCAGGCTCATCCACAAATCAATGA
TTCTGCGCCGCTTAAAGTCCGTGTGCTGTTGTTGAAATCCGATGCGGATTTCATGTCCAGCGACTTCTAT
TCCCTGCAGAACAACGCGTCAGCAACCCTTGGCGCGAATCTGCTGAACAGCGATGTGTTCTTCCTGATGC
CGGGACAGCTGTCGAAAACCCTCAGCGGTCAGAGCGATCCCGAGGCTCGCTACATCGGCGTGATGGCGGA
ATATCAGAAGCTGGATGGTAAAAAATGGCGCGTGTCTCTCCCTCTGCCTGTGCCAGGCGAAAATCATATC
TACCAGTTCTGGAAATGGTCCGCGGATGAACTCCAGGCCAACGTTTTTCTCGACGTAAATGGCATTCGGG
TCATCAGCCAGTAA